Support Portal

Please select a category on the left or use the search.

Search

Part number

Series

Order code

Latest

Explanation F-FO 24/09/2025 Food safety

Associated products

  • Accessories VZS-LFR-HE (8115547)
  • Adapter kit CPPB-G-10-CS (8161105)
  • Adapter kit CPPB-G-16-CS (8161103)
  • Adapter kit CPPB-I-N-CS (8175878)
  • Adapter kit CPPB-K-CS (8161098)
  • Adapter kit CPPB-S-T-CS (8166208)
  • ball valve actuator unit FESTO CS1570573 (8103241)
  • ball valve actuator unit VZSB-3/8"-PC-V-40-3/2T-TAG (8156352)
  • Blanking plug NPQH-P-S10-P10 (578260)
  • Blanking plug NPQH-P-S12-P10 (578261)
  • Blanking plug NPQH-P-S14-P10 (578262)
  • Blanking plug NPQH-P-S4-P10 (578257)
  • Blanking plug NPQH-P-S6-P10 (578258)
  • Blanking plug NPQH-P-S8-P10 (578259)
  • Bulkhead fitting NPQH-H-G14F-Q6-P10 (578297)
  • Bulkhead fitting NPQH-H-G14F-Q8-P10 (578298)
  • Bulkhead fitting NPQH-H-G18F-Q4-P10 (578294)
  • Bulkhead fitting NPQH-H-G18F-Q6-P10 (578295)
  • Bulkhead fitting NPQH-H-G18F-Q8-P10 (578296)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-ND9102FN-(FF) (4348548)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4348552)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-ND9102PN-(PP) (4348551)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-PS2 (4-20MA) (4406353)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-PS2 (FF) (4406351)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-PS2 (HART) (4406352)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-PS2 (PP) (4406495)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-ND9103FN-(FF) (4349181)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-ND9103HN-(4-20MA/HART) (4349180)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-ND9103PN-(PP) (4349183)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-PS2 (4-20MA) (4406573)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-PS2 (FF) (4406574)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-PS2 (HART) (4406571)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-PS2 (PP) (4406709)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-ND9103FN-(FF) (4349914)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-ND9103HN-(4-20MA/HART) (4349912)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-ND9103PN-(PP) (4349913)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-PS2 (4-20MA) (4406795)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-PS2 (FF) (4406796)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-PS2 (HART) (4406792)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-PS2 (PP) (4406900)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-ND9102FN-(FF) (4320763)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4320783)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-ND9102PN-(PP) (4320764)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-PS2 (4-20MA) (4404565)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-PS2 (FF) (4404566)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-PS2 (HART) (4404567)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-PS2 (PP) (4404575)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-ND9102FN-(FF) (4340721)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4340722)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-ND9102PN-(PP) (4340720)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-PS2 (4-20MA) (4404957)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-PS2 (FF) (4404956)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-PS2 (HART) (4404955)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-PS2 (PP) (4405203)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-ND9102FN-(FF) (4346532)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4346533)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-ND9102PN-(PP) (4346531)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-PS2 (4-20MA) (4405835)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-PS2 (FF) (4405831)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-PS2 (HART) (4405832)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-PS2 (PP) (4405841)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-ND9102FN-(FF) (4347175)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4347174)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-ND9102PN-(PP) (4347173)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-PS2 (4-20MA) (4406094)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-PS2 (FF) (4406095)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-PS2 (HART) (4406096)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-PS2 (PP) (4406229)
  • Clip fix tool AGTC-T-SG-1+Z1 (2927784)
  • connecting cable NEBV-Z4WA2L-P-E-0.5-N-M8G3-S1 (8047673)
  • Control block MHA1-PR14+M1H+QSM+KMYZ (540790)
  • Control block SPSB-WELD-2G-SA (3941728)
  • Control cabinet 0990.0035.000.06 (8171731)
  • Control cabinet 0990.LU00.000.68 (8114575)
  • Control cabinet 4408159 (8136949)
  • Control cabinet 90459-3832 VENTING BOX (8046136)
  • Control cabinet LFR+VUVS (8171722)
  • Control cabinet MEYN 0990.BR16.B00.06 (8201120)
  • Control cabinet PN-CPE14-MS4 (8171721)
  • Control cabinet PN-MPAL-SDE5-LFR (8151680)
  • Control cabinet RAPID PLUS M5 (8149820)
  • Control cabinet RAPID-PLUS-M5.0ETHER-CAT (8149818)
  • Control panel 2832309-0005 (8128739)
  • Control panel 2838672-0300 (8064033)
  • Control panel 3097362-0001_AD (8102173)
  • Control panel 3097380-0001_AC (8108830)
  • Control panel 3138670-0001_AA (8103606)
  • Control panel 3156059-0001_AD (8102597)
  • Control panel 3224105-0300_AB (8073734)
  • Control panel 3357976-0100_AC (8070626)
  • Control panel 3371181-1_AG (8235533)
  • Control panel 3409804-0002_AG (8107676)
  • Control panel 3447980-0001_AD (8117160)
  • Control panel 3447980-0002_AC (8117696)
  • Control panel 3447980-0003_AD (8117757)
  • Control panel 3447980-0004_AC (8117763)
  • Control panel 3453500-0001_AA (8107775)
  • Control panel 3468303-1_AD (8202876)
  • Control panel 3468303-6_AC (8202940)
  • Control panel 3496910-0101_AJ (8133522)
  • Control panel 3502315-0001_AA (8107757)
  • Control panel 3502782-0101 (8121350)
  • Control panel 3674436-0100 (8159274)
  • Control panel 3674436-0100_AA (8190340)
  • Control panel 85112401-SIMPLEX-CS (8189070)
  • Control panel BK01-BASIC-SLOW (8085264)
  • Control panel BK03-COMFORT-SLOW (8092489)
  • Control panel BK04-COMFORT-SPEED (8092490)
  • Control panel BK05-COM.-SLOW-DP-EXT (8092535)
  • Control panel BK06-COM.-SPEED-DP-EXT (8092538)
  • Control panel FESTO CS1529414 (5270145)
  • Control panel FESTO CS1529425 (5270273)
  • Control panel FESTO CS1532525 (5333498)
  • Control System YCCP (8061000)
  • Cylinder/valve combination DNG-160- -PPV-A-S6-SA (3446600)
  • Distributor MULTI-COUPLING CPL. (1250947)
  • Distributor SPERR (1441115)
  • End plate kit NEV-3/8-ISO01-CS (5165869)
  • End plate kit NEV-3/8-ISO1-CS (4915437)
  • End-plate fitting-SET CDVI-QS-F-A-U (197922)
  • End-plate fitting-SET CDVI-QS-F-A-V (197923)
  • End-plate fitting-SET CDVI-QS-F-A-Y (197924)
  • End-plate fitting-SET CDVI-QS-F-A-Z (197925)
  • End-plate fitting-SET CDVI-QS-F-B-U (197918)
  • End-plate fitting-SET CDVI-QS-F-B-V (197919)
  • End-plate fitting-SET CDVI-QS-F-B-Y (197920)
  • End-plate fitting-SET CDVI-QS-F-B-Z (197921)
  • End-plate fitting-SET CDVI-QSL-F-C-U (197930)
  • End-plate fitting-SET CDVI-QSL-F-C-V (197931)
  • End-plate fitting-SET CDVI-QSL-F-C-Y (197932)
  • End-plate fitting-SET CDVI-QSL-F-C-Z (197933)
  • End-plate fitting-SET CDVI-QSL-F-D-U (197926)
  • End-plate fitting-SET CDVI-QSL-F-D-V (197927)
  • End-plate fitting-SET CDVI-QSL-F-D-Y (197928)
  • End-plate fitting-SET CDVI-QSL-F-D-Z (197929)
  • Equipment set D:PAL-MECH-STANDARD (8094931)
  • Equipment set D:PAL-MECH-STANDARD-S7-1512C (8206671)
  • Filter LF-M5-D-5M-MICRO-SA (563874)
  • Fine filter MS6-LFM (527670)
  • Fine filter MS6-LFM-1/2-BIRH:*T (570521)
  • Fine filter MS6-LFM-1/2-BIRV:*T (555850)
  • Fine filter MS6-LFM-1/2-BIRVC:*T (547918)
  • Fine filter MS6-LFM-1/2-BRM (529659)
  • Fine filter MS6-LFM-1/2-BRM-DA (536835)
  • Fine filter MS6-LFM-1/2-BRM-DA-Z (536838)
  • Fine filter MS6-LFM-1/2-BRM-Z (529660)
  • Fine filter MS6-LFM-1/2-BRV (530506)
  • Fine filter MS6-LFM-1/2-BRV-DA (536841)
  • Fine filter MS6-LFM-1/2-BRV-DA-Z (536844)
  • Fine filter MS6-LFM-1/2-BRV-Z (530508)
  • Fine filter MS6-LFM-1/2-BUV (529661)
  • Fine filter MS6-LFM-1/2-BUV-DA (536847)
  • Fine filter MS6-LFM-1/2-BUV-DA-Z (536850)
  • Fine filter MS6-LFM-1/2-BUV-HF-DA (552925)
  • Fine filter MS6-LFM-1/2-BUV-Z (529662)
  • Fine filter MS6-LFM-1/2-CIRH:*T (570522)
  • Fine filter MS6-LFM-1/2-CIRV:*T (555851)
  • Fine filter MS6-LFM-1/2-CIRVC:*T (547919)
  • Fine filter MS6-LFM-1/4-BRM (529667)
  • Fine filter MS6-LFM-1/4-BRM-DA (536833)
  • Fine filter MS6-LFM-1/4-BRM-DA-Z (536836)
  • Fine filter MS6-LFM-1/4-BRM-Z (529668)
  • Fine filter MS6-LFM-1/4-BRV (530514)
  • Fine filter MS6-LFM-1/4-BRV-DA (536839)
  • Fine filter MS6-LFM-1/4-BRV-DA-Z (536842)
  • Fine filter MS6-LFM-1/4-BRV-Z (530516)
  • Fine filter MS6-LFM-1/4-BUV (529669)
  • Fine filter MS6-LFM-1/4-BUV-DA (536845)
  • Fine filter MS6-LFM-1/4-BUV-DA-Z (536848)
  • Fine filter MS6-LFM-1/4-BUV-Z (529670)
  • Fine filter MS6-LFM-3/8-BRM (529675)
  • Fine filter MS6-LFM-3/8-BRM-DA (536834)
  • Fine filter MS6-LFM-3/8-BRM-DA-Z (536837)
  • Fine filter MS6-LFM-3/8-BRM-Z (529676)
  • Fine filter MS6-LFM-3/8-BRV (530522)
  • Fine filter MS6-LFM-3/8-BRV-DA (536840)
  • Fine filter MS6-LFM-3/8-BRV-DA-Z (536843)
  • Fine filter MS6-LFM-3/8-BRV-Z (530524)
  • Fine filter MS6-LFM-3/8-BUV (529677)
  • Fine filter MS6-LFM-3/8-BUV-DA (536846)
  • Fine filter MS6-LFM-3/8-BUV-DA-Z (536849)
  • Fine filter MS6-LFM-3/8-BUV-Z (529678)
  • Fine filter MS6N-LFM (527671)
  • Fine filter MS6N-LFM-1/2-A-R-H (8203936)
  • Fine filter MS6N-LFM-1/2-A-R-M-Z (8237478)
  • Fine filter MS6N-LFM-1/2-BRM (531849)
  • Fine filter MS6N-LFM-1/2-BRM-DA (536853)
  • Fine filter MS6N-LFM-1/2-BRM-DA-Z (536856)
  • Fine filter MS6N-LFM-1/2-BRM-Z (531852)
  • Fine filter MS6N-LFM-1/2-B-R-M-Z (8237476)
  • Fine filter MS6N-LFM-1/2-BRV (531855)
  • Fine filter MS6N-LFM-1/2-BRV-DA (536859)
  • Fine filter MS6N-LFM-1/2-BRV-DA-Z (536862)
  • Fine filter MS6N-LFM-1/2-BRV-Z (531858)
  • Fine filter MS6N-LFM-1/2-B-R-V-Z (8237477)
  • Fine filter MS6N-LFM-1/2-BUV (531873)
  • Fine filter MS6N-LFM-1/2-BUV-DA (536865)
  • Fine filter MS6N-LFM-1/2-BUV-DA-Z (536868)
  • Fine filter MS6N-LFM-1/2-BUV-Z (531876)
  • Fine filter MS6N-LFM-1/4-BRM (531848)
  • Fine filter MS6N-LFM-1/4-BRM-DA (536851)
  • Fine filter MS6N-LFM-1/4-BRM-DA-Z (536854)
  • Fine filter MS6N-LFM-1/4-BRM-Z (531851)
  • Fine filter MS6N-LFM-1/4-BRV (531854)
  • Fine filter MS6N-LFM-1/4-BRV-DA (536857)
  • Fine filter MS6N-LFM-1/4-BRV-DA-Z (536860)
  • Fine filter MS6N-LFM-1/4-BRV-Z (531857)
  • Fine filter MS6N-LFM-1/4-BUV (531872)
  • Fine filter MS6N-LFM-1/4-BUV-DA (536863)
  • Fine filter MS6N-LFM-1/4-BUV-DA-Z (536866)
  • Fine filter MS6N-LFM-1/4-BUV-Z (531875)
  • Fine filter MS6N-LFM-3/8-BRM (531850)
  • Fine filter MS6N-LFM-3/8-BRM-DA (536852)
  • Fine filter MS6N-LFM-3/8-BRM-DA-Z (536855)
  • Fine filter MS6N-LFM-3/8-BRM-Z (531853)
  • Fine filter MS6N-LFM-3/8-BRV (531856)
  • Fine filter MS6N-LFM-3/8-BRV-DA (536858)
  • Fine filter MS6N-LFM-3/8-BRV-DA-Z (536861)
  • Fine filter MS6N-LFM-3/8-BRV-Z (531859)
  • Fine filter MS6N-LFM-3/8-BUV (531874)
  • Fine filter MS6N-LFM-3/8-BUV-DA (536864)
  • Fine filter MS6N-LFM-3/8-BUV-DA-Z (536867)
  • Fine filter MS6N-LFM-3/8-BUV-Z (531877)
  • Fine filter-SET MS6-LFM-1/2-BRM (529743)
  • Fine filter-SET MS6-LFM-1/2-BRM-Z (529744)
  • Fine filter-SET MS6-LFM-1/2-BRV (530507)
  • Fine filter-SET MS6-LFM-1/2-BRV-Z (530509)
  • Fine filter-SET MS6-LFM-1/2-BUV (529745)
  • Fine filter-SET MS6-LFM-1/2-BUV-Z (529746)
  • Fine filter-SET MS6-LFM-1/4-BRM (529751)
  • Fine filter-SET MS6-LFM-1/4-BRM-Z (529752)
  • Fine filter-SET MS6-LFM-1/4-BRV (530515)
  • Fine filter-SET MS6-LFM-1/4-BRV-Z (530517)
  • Fine filter-SET MS6-LFM-1/4-BUV (529753)
  • Fine filter-SET MS6-LFM-1/4-BUV-Z (529754)
  • Fine filter-SET MS6-LFM-3/8-BRM (529759)
  • Fine filter-SET MS6-LFM-3/8-BRM-Z (529760)
  • Fine filter-SET MS6-LFM-3/8-BRV (530523)
  • Fine filter-SET MS6-LFM-3/8-BRV-Z (530525)
  • Fine filter-SET MS6-LFM-3/8-BUV (529761)
  • Fine filter-SET MS6-LFM-3/8-BUV-Z (529762)
  • Fine filter-SET MS6N-LFM-1/2-BRM (531885)
  • Fine filter-SET MS6N-LFM-1/2-BRV (531891)
  • Fittings kit-SET CDVI-QS-F-I-A (530493)
  • Fittings kit-SET CDVI-QS-F-I-B (530492)
  • Fittings kit-SET CDVI-QS-F-K-A (530495)
  • Fittings kit-SET CDVI-QS-F-K-B (530494)
  • Fittings-SET CDSV5.0-QS-F-6 (534437)
  • Fittings-SET CDVI-QS-F-G1/8-6 (197937)
  • Fittings-SET CDVI-QS-F-G1/8-8 (197938)
  • Fittings-SET CDVI-QSL-F-G1/8-6 (197939)
  • Fittings-SET CDVI-QSL-F-G1/8-8 (197940)
  • Flat cylinder KDPF-DZF (8217048)
  • Flat cylinder KDPF-DZH (8217047)
  • Handling module DHMZ-DGSL-16- - (8004634)
  • Handling module DHMZ-DGSL-20- - (8004635)
  • Handling system 810_STD_2 (8108180)
  • Installation kit RIP-TYPE 3 (8132617)
  • Installation kit RSU-TYPE 3 (8154431)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(FF)-F (5381002)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(FF)-V (5384630)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(FF)-VR (5384772)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(HART)-F (5367420)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(HART)-V (5365502)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(HART)-VR (5367112)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(PA)-F (5382394)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(PA)-V (5384462)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(PA)-VR (5384773)
  • Linear drive unit DFPI-125-130-ND2P-E-NB3P-LFR-SGS-FNC-ND9102(FF) (4433548)
  • Linear drive unit DFPI-125-130-ND2P-E-NB3P-LFR-SGS-FNC-ND9102(HART) (4433541)
  • Linear drive unit DFPI-125-130-ND2P-E-NB3P-LFR-SGS-FNC-ND9102(PP) (4433542)
  • Linear drive unit DFPI-125-130-ND2P-E-NB3P-LFR-SGS-FNC-PS(4-20MA) (4408037)
  • Linear drive unit DFPI-125-130-ND2P-E-NB3P-LFR-SGS-FNC-PS(FF) (4408042)
  • Linear drive unit DFPI-125-130-ND2P-E-NB3P-LFR-SGS-FNC-PS(HART) (4408032)
  • Linear drive unit DFPI-125-130-ND2P-E-NB3P-LFR-SGS-FNC-PS(PP) (4408023)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(FF)-F (5390211)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(FF)-V (5390206)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(FF)-VR (5390210)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(HART)-F (5390144)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(HART)-V (5389651)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(HART)-VR (5390209)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(PA)-F (5390212)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(PA)-V (5390208)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(PA)-VR (5390207)
  • Linear drive unit DFPI-160-170-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(FF) (4457277)
  • Linear drive unit DFPI-160-170-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(HART) (4457254)
  • Linear drive unit DFPI-160-170-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(PP) (4457278)
  • Linear drive unit DFPI-160-170-ND2P-E-NB3P-LFR-SGS-FNG-PS(4-20MA) (4457495)
  • Linear drive unit DFPI-160-170-ND2P-E-NB3P-LFR-SGS-FNG-PS(FF) (4457496)
  • Linear drive unit DFPI-160-170-ND2P-E-NB3P-LFR-SGS-FNG-PS(HART) (4457478)
  • Linear drive unit DFPI-160-170-ND2P-E-NB3P-LFR-SGS-FNG-PS(PP) (4457497)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(FF)-F (5400983)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(FF)-V (8070075)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(FF)-VR (8070078)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(HART)-F (5400984)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(HART)-V (5402103)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(HART)-VR (8070079)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(PA)-F (5400980)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(PA)-V (8070076)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(PA)-VR (8070077)
  • Linear drive unit DFPI-200-200-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(FF) (4444671)
  • Linear drive unit DFPI-200-200-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(HART) (4444673)
  • Linear drive unit DFPI-200-200-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(PP) (4444674)
  • Linear drive unit DFPI-200-200-ND2P-E-NB3P-LFR-SGS-FNG-PS(4-20MA) (4450328)
  • Linear drive unit DFPI-200-200-ND2P-E-NB3P-LFR-SGS-FNG-PS(FF) (4450344)
  • Linear drive unit DFPI-200-200-ND2P-E-NB3P-LFR-SGS-FNG-PS(HART) (4450291)
  • Linear drive unit DFPI-200-200-ND2P-E-NB3P-LFR-SGS-FNG-PS(PP) (4450345)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(FF)-F (5400762)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(FF)-V (8072787)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(FF)-VR (8072793)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(HART)-F (5397025)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(HART)-V (8072789)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(HART)-VR (8072792)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(PA)-F (5400729)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(PA)-V (8072790)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(PA)-VR (8072791)
  • Linear drive unit DFPI-200-280-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(FF) (4455060)
  • Linear drive unit DFPI-200-280-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(HART) (4455035)
  • Linear drive unit DFPI-200-280-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(PP) (4455061)
  • Linear drive unit DFPI-200-280-ND2P-E-NB3P-LFR-SGS-FNG-PS(4-20MA) (4453478)
  • Linear drive unit DFPI-200-280-ND2P-E-NB3P-LFR-SGS-FNG-PS(FF) (4453479)
  • Linear drive unit DFPI-200-280-ND2P-E-NB3P-LFR-SGS-FNG-PS(HART) (4453277)
  • Linear drive unit DFPI-200-280-ND2P-E-NB3P-LFR-SGS-FNG-PS(PP) (4453480)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(FF)-F (8073111)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(FF)-V (8073127)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(FF)-VR (8073125)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(HART)-F (8073109)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(HART)-V (8073124)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(HART)-VR (8073129)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(PA)-F (8073110)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(PA)-V (8073128)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(PA)-VR (8073126)
  • Linear drive unit DFPI-250-340-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(FF) (4458039)
  • Linear drive unit DFPI-250-340-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(HART) (4458014)
  • Linear drive unit DFPI-250-340-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(PP) (4458040)
  • Linear drive unit DFPI-250-340-ND2P-E-NB3P-LFR-SGS-FNG-PS(4-20MA) (4457624)
  • Linear drive unit DFPI-250-340-ND2P-E-NB3P-LFR-SGS-FNG-PS(FF) (4457626)
  • Linear drive unit DFPI-250-340-ND2P-E-NB3P-LFR-SGS-FNG-PS(HART) (4457609)
  • Linear drive unit DFPI-250-340-ND2P-E-NB3P-LFR-SGS-FNG-PS(PP) (4457627)
  • Linear drive unit DFPI-250-465-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(FF) (4460002)
  • Linear drive unit DFPI-250-465-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(HART) (4459957)
  • Linear drive unit DFPI-250-465-ND2P-E-NB3P-LFR-SGS-FNG-ND9106(PP) (4460003)
  • Linear drive unit DFPI-250-465-ND2P-E-NB3P-LFR-SGS-FNG-PS(4-20MA) (4457931)
  • Linear drive unit DFPI-250-465-ND2P-E-NB3P-LFR-SGS-FNG-PS(FF) (4457932)
  • Linear drive unit DFPI-250-465-ND2P-E-NB3P-LFR-SGS-FNG-PS(HART) (4457924)
  • Linear drive unit DFPI-250-465-ND2P-E-NB3P-LFR-SGS-FNG-PS(PP) (4457933)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(FF)-F (8076782)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(FF)-V (8076856)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(FF)-VR (8076859)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(HART)-F (8076784)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(HART)-V (8076785)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(HART)-VR (8076858)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(PA)-F (8076783)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(PA)-V (8076855)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(PA)-VR (8076857)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-ND9106(FF) (4480474)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-ND9106(HART) (4480477)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-ND9106(PP) (4480478)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-PS(4-20MA) (4597711)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-PS(FF) (4597712)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-PS(HART) (4597621)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-PS(PP) (4597713)
  • Linear drive unit DSBG-125-200-PA-N3-FK-MPA-ND7103HNRREC (8115548)
  • Linear drive unit DSBG-200-350-PA-N3-FK-MPA-ND7106HNRREC (8115703)
  • Linear drive unit DSBG-320-500-PA-N3-SGS-MPA-ND7106HNRREC (8116320)
  • Linear drive DFPI-100- - (5078949)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-A (2184841)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-A-EX-CS (8128873)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-A-HA-EX-CS (8200156)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-R-A (4588304)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-R-A-EX-CS (8128880)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-R-A-HA-EX-CS (8200337)
  • Linear drive DFPI-100- -ND2P-E-NB3P (2185733)
  • Linear drive DFPI-125- - (5087658)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-A (2180905)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-A-EX-CS (8128878)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-A-HA-EX-CS (8200157)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-R-A (4588636)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-R-A-EX-CS (8128879)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-R-A-HA-EX-CS (8200336)
  • Linear drive DFPI-125- -ND2P-E-NB3P (2207685)
  • Linear drive DFPI-125-130-ND2P-E-NB3P-CS (4420092)
  • Linear drive DFPI-160- - (5091793)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-A (2201101)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-A-EX-CS (8128894)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-A-HA-EX-CS (8200158)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-R-A (4588972)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-R-A-EX-CS (8128895)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-R-A-HA-EX-CS (8200338)
  • Linear drive DFPI-160- -ND2P-E-NB3P (2208573)
  • Linear drive DFPI-160-170-ND2P-E-NB3P-CS (4428336)
  • Linear drive DFPI-200- - (5092508)
  • Linear drive DFPI-200- -ND2P-C1V-A (1548030)
  • Linear drive DFPI-200- -ND2P-C1V-NB3P-A (2206373)
  • Linear drive DFPI-200- -ND2P-C1V-NB3P-A-EX-CS (8128901)
  • Linear drive DFPI-200- -ND2P-C1V-NB3P-R-A (4587974)
  • Linear drive DFPI-200- -ND2P-C1V-NB3P-R-A-EX-CS (8128900)
  • Linear drive DFPI-200- -ND2P-C1V-P-A (1548032)
  • Linear drive DFPI-200- -ND2P-E-NB3P (2209613)
  • Linear drive DFPI-200- -ND2P-E-P-G2 (1808245)
  • Linear drive DFPI-200-280-ND2P-E-NB3P-CS (4432768)
  • Linear drive DFPI-250- - (5099770)
  • Linear drive DFPI-250- -ND2P-C1V-A (1548037)
  • Linear drive DFPI-250- -ND2P-C1V-NB3P-A (2200311)
  • Linear drive DFPI-250- -ND2P-C1V-NB3P-A-EX-CS (8128914)
  • Linear drive DFPI-250- -ND2P-C1V-NB3P-R-A (4591209)
  • Linear drive DFPI-250- -ND2P-C1V-NB3P-R-A-EX-CS (8128915)
  • Linear drive DFPI-250- -ND2P-C1V-P-A (1548039)
  • Linear drive DFPI-250- -ND2P-E-NB3P (2210666)
  • Linear drive DFPI-250- -ND2P-E-P-G2 (1808253)
  • Linear drive DFPI-250-465-ND2P-E-NB3P-CS (4435976)
  • Linear drive DFPI-320- - (5106115)
  • Linear drive DFPI-320- -ND2P-C1V-A (1548041)
  • Linear drive DFPI-320- -ND2P-C1V-NB3P-A (2185309)
  • Linear drive DFPI-320- -ND2P-C1V-NB3P-A-EX-CS (8128932)
  • Linear drive DFPI-320- -ND2P-C1V-NB3P-R-A (4591205)
  • Linear drive DFPI-320- -ND2P-C1V-NB3P-R-A-EX-CS (8128931)
  • Linear drive DFPI-320- -ND2P-C1V-P-A (1548044)
  • Linear drive DFPI-320- -ND2P-E-NB3P (2186271)
  • Linear drive DFPI-320- -ND2P-E-P-G2 (1808263)
  • Linear drive DLP-200- -A (542711)
  • Linear drive DLP-200-300-A (548409)
  • Linear drive DLP-200-350-A (548410)
  • Linear drive DLP-200-400-A (548411)
  • Linear drive DLP-200-450-A (548412)
  • Linear drive DLP-200-500-A (548413)
  • Linear drive DLP-250- -A (187483)
  • Linear drive DLP-320- -A (187484)
  • Linear drive KDFP-DFPI (8066876)
  • Manifold assembly ASSEMBLAGGIO VTUG-10 4 POSTI (8108635)
  • Manifold assembly ASSEMBLAGGIO (8111802)
  • Manifold assembly VTUG J70 (8175531)
  • Manifold assembly VTUG-002507-0-0 (4687623)
  • Manifold assembly VTUG-006029-0-0 (4691713)
  • Manifold assembly VTUG-10-SH2-B1T-G18-DT-QH6S-3VDL+W2 (8191480)
  • Manifold assembly VTUG-10-SH2-B1T-G18-DT-QH6S-5VDL+W2 (8191482)
  • Manifold assembly VTUG-10-SH2-B1T-G18-DT-QH6S-7VDL+W2 (8191481)
  • Manifold assembly VTUG-10-SH2-B1T-G18-DT-QH6S-VDL+W2 (8191479)
  • Manifold assembly VTUG-10-SH2-B1T-Q6LA-DT-Q4S-7PKK+* (4340086)
  • Manifold assembly VTUG-10-SH2-B1T-Q6LA-DT-Q4S-HKK6P+* (4339625)
  • Manifold assembly VTUG-10-SH2-B1T-Q6LA-UR-M5S-5A+HW1TV (8217756)
  • Manifold assembly VTUG-10-SH2-B1T-Q6R-DQR-Q4S-14PJLCC+W1 (8202322)
  • Manifold assembly VTUG-10-SH2-B1T-Q6R-UR-Q4S-14PJLCC+W1 (8202321)
  • Manifold assembly VTUG-10-SH2-B1T-Q6R-UR-Q4S-15PLCC+W1 (8202323)
  • Manifold assembly VTUG-10-SH2-B1T-Q8L-UL-Q4S-6P+W1 (8202320)
  • Manifold assembly VTUG-10-SH2-B1T-Q8L-UL-Q4S-GA+W3 (8204524)
  • Manifold assembly VTUG-10-SH2-B1T-Q8-UR-Q6S-JTPJJ+C1TV (8167036)
  • Manifold assembly VTUG-10-SH2-S1T-G18-DTL-Q4S-4VDTPG+TV (8182144)
  • Manifold assembly VTUG-10-SH2-S1T-G18-DTR-Q4S-4KTPG+TV (8183115)
  • Manifold assembly VTUG-10-SH2-S1T-G18L-UL-M5S-3GL+W1 (8191370)
  • Manifold assembly VTUG-10-SH2-S1T-Q10A-U-Q4S-4J4P4A4G+W1 (8159026)
  • Manifold assembly VTUG-10-SH2-S1T-Q10LA-DT-Q4S-4VK+W1 (8191371)
  • Manifold assembly VTUG-10-SH2-S1T-Q10L-UL-Q6S-3VM+W1 (8163851)
  • Manifold assembly VTUG-10-SH2-S1T-Q10L-UL-Q6S-8VM+W1 (8163685)
  • Manifold assembly VTUG-10-SH2-S1T-Q6L-UL-Q4S-JJLL+W1 (8240244)
  • Manifold assembly VTUG-10-SH2-S1T-Q6R-DQR-Q4S-14PJL+W1 (8202325)
  • Manifold assembly VTUG-10-SH2-S1T-Q6R-UR-Q4S-14PJL+W1 (8202324)
  • Manifold assembly VTUG-10-SH2-S1T-Q6R-UR-Q4S-15PL+W1 (8202326)
  • Manifold assembly VTUG-10-SH2-S1T-Q8LA-DTR-Q4SFB-4VDGG+TV (8182147)
  • Manifold assembly VTUG-10-SH2-S1T-Q8L-UL-Q6S-GGK+W3 (8204526)
  • Manifold assembly VTUG-10-SH2-S1T-Q8L-UL-Q6S-GKL+W3 (8204525)
  • Manifold assembly VTUG-10-SH3-S1T-Q6LA-UL-Q4S-3J+C2TV (8167037)
  • Manifold assembly VTUG-10-SH3-S1T-Q8L-DTL-Q4S-3PL+W1 (8176746)
  • Manifold assembly VTUG-10-SK6-B1T-Q10L-UL-Q6S-12JLL (8170876)
  • Manifold assembly VTUG-10-SK6-S1T-Q10LA-UL-Q6S-JJP (8191372)
  • Manifold assembly VTUG-10-SK7-B1T-Q8RA-UR-Q6S-3J+TV (8170877)
  • Manifold assembly VTUG-10-SK8-B1T-Q10LA-UL-Q6S-EE4J (8167038)
  • Manifold assembly VTUG-10-SK8-B1T-Q10LA-U-Q6S-3J (8167039)
  • Manifold assembly VTUG-10-SK8-B1T-Q10RA-U-Q6S-3J (8167040)
  • Manifold assembly VTUG-10-SK8-B1T-Q6RA-UR-Q6S-4J (8170879)
  • Manifold assembly VTUG-10-SK8-B1T-Q8LA-UL-Q6S-4J (8170880)
  • Manifold assembly VTUG-10-SK8-B1T-Q8LA-UL-Q6S-GG (8170881)
  • Manifold assembly VTUG-10-SK8-B1T-Q8LA-UL-Q6S-JJ (8170882)
  • Manifold assembly VTUG-10-SK8-B1T-Q8L-UL-Q4S-6J (8170883)
  • Manifold assembly VTUG-10-SK8-B1T-Q8L-UL-Q6S-4J (8170884)
  • Manifold assembly VTUG-10-SK8-B1T-Q8L-U-Q6S-4J (8170885)
  • Manifold assembly VTUG-10-SK8-B1T-Q8RA-U-Q4S-3J (8167041)
  • Manifold assembly VTUG-10-SK8-B1T-Q8RA-UR-Q6S-3G+TV (8170886)
  • Manifold assembly VTUG-10-SK8-B1T-Q8RA-UR-Q6S-3J (8170887)
  • Manifold assembly VTUG-10-SK8-S1T-Q8LA-UL-Q4SFA-4P (8170888)
  • Manifold assembly VTUG-10-SK8-S1T-Q8LA-UL-Q6S-3J (8170889)
  • Manifold assembly VTUG-10-SK8-S1T-Q8L-UL-Q4S-3J (8167042)
  • Manifold assembly VTUG-10-SK8-S1T-Q8L-UR-Q6S-5J (8170890)
  • Manifold assembly VTUG-10-SR8-B1T-G18-DT-QH6S-JJ3LTSPQM7* (8023766)
  • Manifold assembly VTUG-10-SR8-B1T-Q10L-UL-Q6S-6GLL (8219458)
  • Manifold assembly VTUG-10-SR8-S1T-G18L-UL-Q6S-KK4L (8207251)
  • Manifold assembly VTUG-10-SR8-S1T-Q10L-UL-Q6S-3AJ (8210066)
  • Manifold assembly VTUG-10-SR8-S1T-Q10-U-M7S-4ATSASTSGG (8172793)
  • Manifold assembly VTUG-10-SR8-S1T-Q6L-UL-Q6S-4G (8219459)
  • Manifold assembly VTUG-10-SS3-S1T-Q8LA-UL-Q6S-7A (8189663)
  • Manifold assembly VTUG-10-SS3-S1T-Q8LA-UL-Q6S-L11A (8189662)
  • Manifold assembly VTUG-14099-0094-5-0 (8025486)
  • Manifold assembly VTUG-14099-0095-4-0 (8025487)
  • Manifold assembly VTUG-14099-1011-0-0 (8028472)
  • Manifold assembly VTUG-14099-1012-0-0 (8028473)
  • Manifold assembly VTUG-14099-1023-0-0 (8033111)
  • Manifold assembly VTUG-14099-1024-0-0 (8033110)
  • Manifold assembly VTUG-14099-1025-1-0 (8033108)
  • Manifold assembly VTUG-14099-1027-0-0 (8033109)
  • Manifold assembly VTUG-14-SH2-B1TZ-Q10L-DQL-Q6S-4G+W1 (8170891)
  • Manifold assembly VTUG-14-SH2R-S1T-G14-DT-G18S-3ML+W4 (8201467)
  • Manifold assembly VTUG-14-SH2R-S1T-G14-DT-G18S-4G+W4 (8201468)
  • Manifold assembly VTUG-14-SH2-S1H-Q12L-U-Q8S-GKKLL (8219460)
  • Manifold assembly VTUG-14-SH2-S1T-G14L-UL-G18S-10M+W1 (8191373)
  • Manifold assembly VTUG-14-SH2-S1T-G14L-UL-G18S-4M+C1 (8182832)
  • Manifold assembly VTUG-14-SH2-S1T-G14L-UL-G18S-5M+C1 (8182836)
  • Manifold assembly VTUG-14-SH2-S1T-G14L-UL-G18S-6M+C1 (8182833)
  • Manifold assembly VTUG-14-SH2-S1T-G14-U-G18S-5M+C1 (8182835)
  • Manifold assembly VTUG-14-SH2-S1T-G14-U-G18S-8M+C1 (8182834)
  • Manifold assembly VTUG-14-SH2-S1T-Q10LA-UL-Q4S-4M+W1 (8191374)
  • Manifold assembly VTUG-14-SH2-S1T-Q10LA-UL-Q6S-3JLL+W1 (8144935)
  • Manifold assembly VTUG-14-SH2-S1T-Q10LA-UL-Q6S-JJM+W1 (8175090)
  • Manifold assembly VTUG-14-SH2-S1T-Q10RA-UL-Q6S-4GLL (8205004)
  • Manifold assembly VTUG-14-SH2-S1T-Q12A-DTL-Q6S-4M7GL+W1 (8175091)
  • Manifold assembly VTUG-14-SH2-S1T-Q12A-UL-Q6S-12M+W1 (8191375)
  • Manifold assembly VTUG-14-SH2-S1T-Q12A-UL-Q6S-GMLLTP4M+W1 (8191376)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-12M+W1 (8175092)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-3MGG5L+W1 (8175093)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-4G4L+W1 (8175094)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-5G5L+W1 (8171149)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-6GMMLL+W1 (8175095)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-6M+W1 (8175096)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-7GQ8GQ8LL+W1 (8175097)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-7GQ8L+W1 (8175098)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-8GLL+W1 (8175099)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-8MLL+W1 (8175100)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-GMM5L+W1 (8175101)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-M9G+W1 (8175102)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q6S-MMQ8MQ8MML+W1 (8175103)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DTL-Q8S-8M+W1 (8175104)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-DT-Q6S-7GMML+W1 (8175105)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-U-G18S-EE4J+W1 (8191377)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q4S-5J3L+W1 (8175106)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q4S-6JLL+W1 (8175107)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q4S-6M+W1 (8175108)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q4S-7JL+W1 (8175109)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-10M+W1 (8191378)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-12M+W1 (8191379)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-3M3L+W1 (8191380)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-4G4J4A4L+W1 (8159025)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-4G4J4M+W1 (8159022)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-4MQ4+W1 (8175110)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-5MQ4MQ4ML+W1 (8175111)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-6MQ4MQ4L+W1 (8175112)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-GGLL+W1 (8159021)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-GJJQ4JQ4JQ4E+W1 (8175113)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-JJG3L+W1 (8175114)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-JJMQ4MQ4LL+W1 (8175115)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-JQ4EJQ4E+W1 (8175116)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-JQ4JJQ43J+W1 (8175117)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-MM4G4J+W1 (8159020)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q6S-MQ8MQ4MQ4MMQ4L+W1 (8175118)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UL-Q8S-4J+W1 (8191381)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-U-Q6S-JJMMJJMMJJMM+W1 (8191382)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UR-Q6S-3VMLL+W1 (8191383)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UR-Q6S-4EGGAA+W1 (8159019)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UR-Q6S-6E+W1 (8159018)
  • Manifold assembly VTUG-14-SH2-S1T-Q12LA-UR-Q8S-4AQ6LL+W1 (8191384)
  • Manifold assembly VTUG-14-SH2-S1T-Q12L-UL-Q6S-8VM+W1 (8164666)
  • Manifold assembly VTUG-14-SH2-S1T-Q8L-UL-Q6SFA-6J+C1 (8167043)
  • Manifold assembly VTUG-14-SH2-S1TZ-Q12LA-DT-Q6S-GGLL+W1 (8191385)
  • Manifold assembly VTUG-14-SH3-S1T-Q8LA-UL-Q6S-GG+C5TV (8184698)
  • Manifold assembly VTUG-14-SK6-B1T-Q10R-UR-Q6S-3J+TV (8167044)
  • Manifold assembly VTUG-14-SK6-S1T-Q10LA-UL-Q8S-JJ (8184699)
  • Manifold assembly VTUG-14-SK7-B1T-Q10L-UL-Q6S-4J+TV (8167045)
  • Manifold assembly VTUG-14-SK7-B1T-Q10L-UL-Q6S-5J+TV (8167046)
  • Manifold assembly VTUG-14-SK7-B1T-Q10L-UL-Q8S-3J+TV (8167047)
  • Manifold assembly VTUG-14-SK7-B1T-Q10L-UL-Q8S-4G+TV (8170892)
  • Manifold assembly VTUG-14-SK7-B1T-Q10L-UL-Q8S-4J (8167048)
  • Manifold assembly VTUG-14-SK7-B1T-Q10L-UL-Q8S-5G+TV (8167049)
  • Manifold assembly VTUG-14-SK7-B1T-Q10R-UR-Q6S-4J+TV (8170893)
  • Manifold assembly VTUG-14-SK7-B1T-Q8L-UL-Q6S-4J (8167051)
  • Manifold assembly VTUG-14-SK7-B1T-Q8L-UL-Q8S-3J (8167053)
  • Manifold assembly VTUG-14-SK7-B1T-Q8R-UR-Q6S-3J+TV (8167054)
  • Manifold assembly VTUG-14-SK7-S1T-Q10RA-UL-Q6S-J3G+TV (8170894)
  • Manifold assembly VTUG-14-SK7-S1T-Q10-U-Q6S-KK8J (8167055)
  • Manifold assembly VTUG-14-SK7-S1T-Q8L-UL-Q6SFB-J3G+TV (8170895)
  • Manifold assembly VTUG-14-SK7-S1T-Q8L-UL-Q6S-K5J (8167056)
  • Manifold assembly VTUG-14-SK8-B1T-Q10LA-UL-Q6S-4E (8167066)
  • Manifold assembly VTUG-14-SK8-B1T-Q10LA-UL-Q8S-3J (8167057)
  • Manifold assembly VTUG-14-SK8-B1T-Q10L-UL-Q6S-3GQ8 (8167058)
  • Manifold assembly VTUG-14-SK8-B1T-Q10L-UL-Q6S-4GQ8 (8167059)
  • Manifold assembly VTUG-14-SK8-B1T-Q10RA-U-Q8S-GG+TV (8167060)
  • Manifold assembly VTUG-14-SK8-B1T-Q10RA-UR-Q6S-4J (8167067)
  • Manifold assembly VTUG-14-SK8-B1T-Q10RA-UR-Q6S-A3J (8170896)
  • Manifold assembly VTUG-14-SK8-B1T-Q10RA-UR-Q8S-3J (8167061)
  • Manifold assembly VTUG-14-SK8-B1T-Q10R-UR-Q6S-8J (8170897)
  • Manifold assembly VTUG-14-SK8-B1T-Q8LA-UL-Q6S-6J (8170898)
  • Manifold assembly VTUG-14-SK8-B1T-Q8L-UL-Q6S-3J+TV (8167062)
  • Manifold assembly VTUG-14-SK8-S1T-Q10LA-UL-Q6SFA-4G (8170899)
  • Manifold assembly VTUG-14-SK8-S1T-Q10L-UL-Q6S-4J (8167063)
  • Manifold assembly VTUG-14-SK8-S1T-Q10RA-UR-Q6SFC-8J4B (8170900)
  • Manifold assembly VTUG-14-SK8-S1T-Q10R-UL-Q8S-JQ6JQ6J+TV (8170901)
  • Manifold assembly VTUG-14-SK8-S1T-Q10R-UL-Q8S-JQ6JQ6JQ6J+TV (8170902)
  • Manifold assembly VTUG-14-SK8-S1T-Q10R-U-Q8S-JQ6JQ6J+TV (8170903)
  • Manifold assembly VTUG-14-SK8-S1T-Q8LA-UL-Q6SFA-4G (8170904)
  • Manifold assembly VTUG-14-SK8-S1T-Q8LA-UL-Q6SFA-4J (8170905)
  • Manifold assembly VTUG-14-SK8-S1T-Q8L-UL-Q6S-3J (8170906)
  • Manifold assembly VTUG-14-SK8-S1T-Q8L-UL-Q6S-JJ (8170907)
  • Manifold assembly VTUG-14-SK8-S1T-Q8L-UL-Q8SFC-JJ (8170908)
  • Manifold assembly VTUG-14-SK9-S1T-Q10LA-UL-Q6SFA-3J (8170909)
  • Manifold assembly VTUG-14-SK9-S1T-Q10LA-UL-Q6SFA-4J (8167064)
  • Manifold assembly VTUG-14-SK9-S1T-Q8LA-UR-Q6S-3J (8167065)
  • Manifold assembly VTUG-14-SK9-S1T-Q8L-UL-Q6SFC-4J (8170910)
  • Manifold assembly VTUG-14-SL2-B1T-Q12L-U-Q6S-EJA3J3AL (8215800)
  • Manifold assembly VTUG-14-SL3-S1T-Q10A-U-Q6S-GGJJ (8170911)
  • Manifold assembly VTUG-14-SR8-B1H-G14L-UL-Q6S-EQ8AL (8201326)
  • Manifold assembly VTUG-14-SR8-B1H-G14L-UL-Q6S-EQ8EEAAL (8201327)
  • Manifold assembly VTUG-14-SR8-B1H-G14-UR-G18S-10A (8201331)
  • Manifold assembly VTUG-14-SR8-B1H-G14-UR-G18S-4EL (8201336)
  • Manifold assembly VTUG-14-SR8-B1H-G14-UR-G18S-6EAALL (8201338)
  • Manifold assembly VTUG-14-SR8-B1H-G14-UR-G18S-7AL (8201334)
  • Manifold assembly VTUG-14-SR8-B1H-G14-UR-G18S-8ALL (8201337)
  • Manifold assembly VTUG-14-SR8-B1H-G14-UR-G18S-9AL (8201332)
  • Manifold assembly VTUG-14-SR8-B1H-Q12L-UL-Q8S-LECCEQ6EQ6ACCXQ6+H (8201330)
  • Manifold assembly VTUG-14-SR8-B1H-Q12-U-Q6S-EEAAGL (8191613)
  • Manifold assembly VTUG-14-SR8-B1T-Q10L-UL-Q6S-3GLL (8219461)
  • Manifold assembly VTUG-14-SR8-B1T-Q10L-UL-Q6S-4GL (8219462)
  • Manifold assembly VTUG-14-SR8-B1T-Q10L-UL-Q6S-GL (8219463)
  • Manifold assembly VTUG-14-SR8-B1T-Q10L-UL-Q8S-GKLL (8219464)
  • Manifold assembly VTUG-14-SR8-B1T-Q12L-UL-Q6S-GGKL (8219465)
  • Manifold assembly VTUG-14-SR8-B1T-Q12L-UL-Q6S-GGL (8219466)
  • Manifold assembly VTUG-14-SR8-B1T-Q12L-UL-Q6S-GGLL (8219467)
  • Manifold assembly VTUG-14-SR8-B1T-Q12L-UL-Q8S-GG3L (8219468)
  • Manifold assembly VTUG-14-SR8-B1T-Q12L-UL-Q8S-GGEEL (8205005)
  • Manifold assembly VTUG-14-SR8-B1TZ-Q8L-UL-Q8S-AA3JA (8217486)
  • Manifold assembly VTUG-14-SR8R-S1T-Q10-UL-G18S-MMLMTPL (8186803)
  • Manifold assembly VTUG-14-SR8-S1H- -AECPECP+:SM (8162173)
  • Manifold assembly VTUG-14-SR8-S1H-Q12L-U-Q6S-3GQ4GQ4L (8201329)
  • Manifold assembly VTUG-14-SR8-S1H-Q12L-U-Q8S-EEQ6GQ4GQ4L (8201339)
  • Manifold assembly VTUG-14-SR8-S1T-G14-DTR-G18S-VMVDTPVJ (8216630)
  • Manifold assembly VTUG-14-SR8-S1T-Q10L-UR-Q6S-5M (8243958)
  • Manifold assembly VTUG-14-SR8-S1T-Q10-UL-Q6S-4GLL (8219469)
  • Manifold assembly VTUG-14-SR8-S1T-Q10-UL-Q6S-5GLL (8219470)
  • Manifold assembly VTUG-14-SR8-S1T-Q12L-U-Q8S-GKKLL (8219471)
  • Manifold assembly VTUG-14-SR8-S1T-Q12RA-DTR-G18S-A5J+:SM (8049717)
  • Manifold assembly VTUG-14-SR8-S1T-Q8LA-UL-Q6S-3GL (8219472)
  • Manifold assembly VTUG-14-SR8-S1T-Q8LA-UL-Q6S-4G (8219473)
  • Manifold assembly VTUG-14-SR8-S1T-Q8LA-UL-Q6S-GGKKLL (8219474)
  • Manifold assembly VTUG-14-SR8-S1T-Q8LA-UL-Q6S-GGLL (8219475)
  • Manifold assembly VTUG-14-SR8-S1T-Q8LA-UR-Q6S-3GKL (8219476)
  • Manifold assembly VTUG-14-SR8-S1T-Q8LA-UR-Q6S-GGEL (8205006)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-4ELL (8205010)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-4GL (8219479)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-4GLL (8219480)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-5GKL (8219482)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-5GL (8205035)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-6GL (8219483)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-E4GL (8205036)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-G3ELL (8205012)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-G3JL (8205013)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-GELL (8205011)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-GG (8205007)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-GGEELL (8205014)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-GGEL (8205008)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-GGK3L (8205015)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-GGKKL (8219477)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-GGL (8219484)
  • Manifold assembly VTUG-14-SR8-S1T-Q8L-UL-Q6S-GGLL (8205009)
  • Manifold assembly VTUG-14-SR8-S1T-Q8RA-UL-Q6S-4GKLL (8219485)
  • Manifold assembly VTUG-14-SR8-S1T-Q8RA-UL-Q6S-GGLL (8219486)
  • Manifold assembly VTUG-14-SS2-S1T-Q12L-UR-Q8S-3J+S4 (8184700)
  • Manifold assembly VTUG-18-SH2-B1TZ-Q12A-DT-Q8S-GGTSGL+W1 (8191459)
  • Manifold assembly VTUG-18-SH2-S1T-G38L-UL-G14S-6G+W1 (8191460)
  • Manifold assembly VTUG-18-SH2-S1T-Q10LA-DTL-Q8S-10GLL+W1 (8159017)
  • Manifold assembly VTUG-18-SH2-S1T-Q10LA-DTL-Q8S-4GLL+W1 (8159016)
  • Manifold assembly VTUG-18-SH2-S1T-Q10LA-DTL-Q8S-6GLL+W1 (8159013)
  • Manifold assembly VTUG-18-SH2-S1T-Q10LA-DTL-Q8S-8GLL+W1 (8159012)
  • Manifold assembly VTUG-18-SH2-S1T-Q10LA-DT-Q8S-4GTR4G+W1 (8191461)
  • Manifold assembly VTUG-18-SH2-S1T-Q10L-UL-G14S-5P (8189641)
  • Manifold assembly VTUG-18-SH2-S1T-Q12A-UL-Q10S-5GL+W1 (8175119)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-DQL-Q10S-4G6L+W1 (8171150)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-DQL-Q10S-5G5A+W1 (8175121)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-DQL-Q10S-AAL+W1 (8175120)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-DQL-Q6S-9AL+W1 (8175122)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-DTL-Q6S-4GQ8PPQ8PP+W1 (8191462)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-DT-Q10S-AA+W1 (8159011)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-UL-Q10S-4G+W1 (8191464)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-UL-Q8S-PQ10GGL+W1 (8175123)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-U-Q10S-6J+W1 (8191465)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-U-Q10S-AAQ8AAQ8+W1 (8191463)
  • Manifold assembly VTUG-18-SH2-S1T-Q12LA-UR-Q10S-GGA+W1 (8191466)
  • Manifold assembly VTUG-18-SH2-S1TZ-G38L-DTL-G14S-5G+W1 (8191467)
  • Manifold assembly VTUG-18-SH2-S1TZ-Q10LA-DT-Q8S-4GTRGGLL+W1 (8159010)
  • Manifold assembly VTUG-18-SH2-S1TZ-Q10LA-DT-Q8S-5GTR5G+W1 (8159009)
  • Manifold assembly VTUG-18-SH2-S1TZ-Q10LA-DT-Q8S-GGTRGG+W1 (8159008)
  • Manifold assembly VTUG-18-SH2-S1TZ-Q12A-DTL-Q8S-12A+W1 (8159007)
  • Manifold assembly VTUG-18-SH2-S1TZ-Q8LA-DTL-Q8S-3G3L+W1 (8175124)
  • Manifold assembly VTUG-18-SH2-S1TZ-Q8LA-DT-Q8S-4G+W1 (8191468)
  • Manifold assembly VTUG-18-SH3-B1T-Q12L-DQL-Q10S-PQ8PGLCCLCC (8225120)
  • Manifold assembly VTUG-18-SK6-S1T-Q12LA-DTR-Q8S-GE (8191469)
  • Manifold assembly VTUG-18-SK6-S1TZ-G38L-DTL-G14S-5G (8191470)
  • Manifold assembly VTUG-18-SK6-S1TZ-Q12LA-DT-Q8S-GXCCGXCC (8191471)
  • Manifold assembly VTUG-18-SK7-B1T-Q10R-UR-Q8S-GJJ (8170912)
  • Manifold assembly VTUG-18-SK7-B1T-Q16LA-U-G14S-JJ (8176757)
  • Manifold assembly VTUG-18-SK8-B1T-G38-DT-Q10S-GJQ8 (8176762)
  • Manifold assembly VTUG-18-SK9-B1T-Q12R-U-Q10S-JJQ8G (8176756)
  • Manifold assembly VTUG-18-SR8-B1T-Q10L-U-Q6S-JJ+N4 (8176763)
  • Manifold assembly VTUG-18-SR8-B1T-Q10L-U-Q8S-3J+N1 (8176760)
  • Manifold assembly VTUG-18-SR8-B1T-Q10L-U-Q8S-4J+N1 (8176759)
  • Manifold assembly VTUG-18-SR8-B1T-Q10L-U-Q8S-JJ+N1 (8176761)
  • Manifold assembly VTUG-18-SR8-S1H-Q12LA-UR-Q10SFC-EQ8EQ8EQ6PQ6L+H (8201333)
  • Manifold assembly VTUG-18-SR8-S1H-Q12L-U-Q10S-PQ6XCCPQ6XCCPXCCLL (8201340)
  • Manifold assembly VTUG-18-SR8-S1H-Q12L-UR-Q10SFA-EQ8EQ8EQ6PQ6L+H (8201335)
  • Manifold assembly VTUG-18-SR8-S1H-Q12R-UL-Q10S-EQ6EQ8PXCCL+H (8201341)
  • Manifold assembly VTUG-18-SR8-S1T-Q10L-U-G14S-EQ10EQ6A (8243957)
  • Manifold assembly VTUG-18-SR8-S1T-Q10L-UL-Q6S-G4KL (8219487)
  • Manifold assembly VTUG-18-SR8-S1T-Q10L-UL-Q8S-GKLL (8219488)
  • Manifold assembly VTUG-18-SR8-S1T-Q12L-UL-Q8S-4GEL (8205037)
  • Manifold assembly VTUG-S "R8...VMVMLQG18LQG18..." (8069973)
  • Manifold assembly VTUG-S ASSEMBLY 002507.0.0 (8095117)
  • Manifold assembly VTUG-S ASSEMBLY 002630.1.0 (8095143)
  • Manifold assembly VTUG-S ASSEMBLY 002646.0.0 (8095157)
  • Manifold assembly VTUG-S ASSEMBLY 004877.0.0 (8095165)
  • Manifold assembly VTUG-S ASSEMBLY 014781.0.0 (8095167)
  • Manifold assembly VTUG-S ASSEMBLY 014986.0.0 (8095175)
  • Manifold assembly VTUG-S ASSEMBLY 025725.0.0 (8095441)
  • Manifold assembly VTUG-S ASSEMBLY 025726.0.0 (8095439)
  • Manifold assembly VTUG-S ASSEMBLY 14099_0095_4_0 (8095192)
  • Manifold assembly VTUG-S ASSEMBLY 14099_1012_0_0 (8095295)
  • Manifold assembly VTUG-S ASSEMBLY 14099_1016_1_0 (8095350)
  • Manifold assembly VTUG-S ASSEMBLY 14099_1018_1_0 (8095366)
  • Manifold assembly VTUG-S ASSEMBLY 14099_1026_0_0 (8095393)
  • Manifold assembly VTUG-S ASSEMBLY 14099_1027_0_0 (8095418)
  • Manifold assembly VTUG-S (572230)
  • Micro filter MS6-LFM-1/2-AIRH:*T (570520)
  • Micro filter MS6-LFM-1/2-AIRV:*T (555849)
  • Micro filter MS6-LFM-1/2-AIRVC:*T (547917)
  • Micro filter MS6-LFM-1/2-AR-HF-DA:*W (553873)
  • Micro filter MS6-LFM-1/2-ARM (529655)
  • Micro filter MS6-LFM-1/2-ARM-DA (536871)
  • Micro filter MS6-LFM-1/2-ARM-DA-Z (536874)
  • Micro filter MS6-LFM-1/2-ARM-Z (529656)
  • Micro filter MS6-LFM-1/2-ARV (530502)
  • Micro filter MS6-LFM-1/2-ARV-DA (536877)
  • Micro filter MS6-LFM-1/2-ARV-DA-Z (536880)
  • Micro filter MS6-LFM-1/2-ARV-Z (530504)
  • Micro filter MS6-LFM-1/2-AUV (529657)
  • Micro filter MS6-LFM-1/2-AUV-DA (536883)
  • Micro filter MS6-LFM-1/2-AUV-DA-Z (536886)
  • Micro filter MS6-LFM-1/2-AUV-HF-DA (552926)
  • Micro filter MS6-LFM-1/2-AUV-Z (529658)
  • Micro filter MS6-LFM-1/4-ARM (529663)
  • Micro filter MS6-LFM-1/4-ARM-DA (536869)
  • Micro filter MS6-LFM-1/4-ARM-DA-Z (536872)
  • Micro filter MS6-LFM-1/4-ARM-Z (529664)
  • Micro filter MS6-LFM-1/4-ARV (530510)
  • Micro filter MS6-LFM-1/4-ARV-DA (536875)
  • Micro filter MS6-LFM-1/4-ARV-DA-Z (536878)
  • Micro filter MS6-LFM-1/4-ARV-Z (530512)
  • Micro filter MS6-LFM-1/4-AUV (529665)
  • Micro filter MS6-LFM-1/4-AUV-DA (536881)
  • Micro filter MS6-LFM-1/4-AUV-DA-Z (536884)
  • Micro filter MS6-LFM-1/4-AUV-Z (529666)
  • Micro filter MS6-LFM-3/8-AR-DA:*W (553871)
  • Micro filter MS6-LFM-3/8-ARM (529671)
  • Micro filter MS6-LFM-3/8-ARM-DA (536870)
  • Micro filter MS6-LFM-3/8-ARM-DA-Z (536873)
  • Micro filter MS6-LFM-3/8-ARM-Z (529672)
  • Micro filter MS6-LFM-3/8-ARV (530518)
  • Micro filter MS6-LFM-3/8-ARV-DA (536876)
  • Micro filter MS6-LFM-3/8-ARV-DA-Z (536879)
  • Micro filter MS6-LFM-3/8-ARV-Z (530520)
  • Micro filter MS6-LFM-3/8-AUV (529673)
  • Micro filter MS6-LFM-3/8-AUV-DA (536882)
  • Micro filter MS6-LFM-3/8-AUV-DA-Z (536885)
  • Micro filter MS6-LFM-3/8-AUV-Z (529674)
  • Micro filter MS6N-LFM-1/2-AR-HF-DA:*W (553874)
  • Micro filter MS6N-LFM-1/2-ARM (531861)
  • Micro filter MS6N-LFM-1/2-ARM-DA (536889)
  • Micro filter MS6N-LFM-1/2-ARM-DA-Z (536892)
  • Micro filter MS6N-LFM-1/2-ARM-Z (531864)
  • Micro filter MS6N-LFM-1/2-ARV (531867)
  • Micro filter MS6N-LFM-1/2-ARV-DA (536895)
  • Micro filter MS6N-LFM-1/2-ARV-DA-Z (536898)
  • Micro filter MS6N-LFM-1/2-ARV-Z (531870)
  • Micro filter MS6N-LFM-1/2-AUV (531879)
  • Micro filter MS6N-LFM-1/2-AUV-DA (536901)
  • Micro filter MS6N-LFM-1/2-AUV-DA-Z (536904)
  • Micro filter MS6N-LFM-1/2-AUV-Z (531882)
  • Micro filter MS6N-LFM-1/4-ARM (531860)
  • Micro filter MS6N-LFM-1/4-ARM-DA (536887)
  • Micro filter MS6N-LFM-1/4-ARM-DA-Z (536890)
  • Micro filter MS6N-LFM-1/4-ARM-Z (531863)
  • Micro filter MS6N-LFM-1/4-ARV (531866)
  • Micro filter MS6N-LFM-1/4-ARV-DA (536893)
  • Micro filter MS6N-LFM-1/4-ARV-DA-Z (536896)
  • Micro filter MS6N-LFM-1/4-ARV-Z (531869)
  • Micro filter MS6N-LFM-1/4-AUV (531878)
  • Micro filter MS6N-LFM-1/4-AUV-DA (536899)
  • Micro filter MS6N-LFM-1/4-AUV-DA-Z (536902)
  • Micro filter MS6N-LFM-1/4-AUV-Z (531881)
  • Micro filter MS6N-LFM-3/8-AR-DA:*W (553872)
  • Micro filter MS6N-LFM-3/8-ARM (531862)
  • Micro filter MS6N-LFM-3/8-ARM-DA (536888)
  • Micro filter MS6N-LFM-3/8-ARM-DA-Z (536891)
  • Micro filter MS6N-LFM-3/8-ARM-Z (531865)
  • Micro filter MS6N-LFM-3/8-ARV (531868)
  • Micro filter MS6N-LFM-3/8-ARV-DA (536894)
  • Micro filter MS6N-LFM-3/8-ARV-DA-Z (536897)
  • Micro filter MS6N-LFM-3/8-ARV-Z (531871)
  • Micro filter MS6N-LFM-3/8-AUV (531880)
  • Micro filter MS6N-LFM-3/8-AUV-DA (536900)
  • Micro filter MS6N-LFM-3/8-AUV-DA-Z (536903)
  • Micro filter MS6N-LFM-3/8-AUV-Z (531883)
  • Micro filter-SET MS6-LFM-1/2-ARM (529739)
  • Micro filter-SET MS6-LFM-1/2-ARM-Z (529740)
  • Micro filter-SET MS6-LFM-1/2-ARV (530503)
  • Micro filter-SET MS6-LFM-1/2-ARV-Z (530505)
  • Micro filter-SET MS6-LFM-1/2-AUV (529741)
  • Micro filter-SET MS6-LFM-1/2-AUV-Z (529742)
  • Micro filter-SET MS6-LFM-1/4-ARM (529747)
  • Micro filter-SET MS6-LFM-1/4-ARM-Z (529748)
  • Micro filter-SET MS6-LFM-1/4-ARV (530511)
  • Micro filter-SET MS6-LFM-1/4-ARV-Z (530513)
  • Micro filter-SET MS6-LFM-1/4-AUV (529749)
  • Micro filter-SET MS6-LFM-1/4-AUV-Z (529750)
  • Micro filter-SET MS6-LFM-3/8-ARM (529755)
  • Micro filter-SET MS6-LFM-3/8-ARM-Z (529756)
  • Micro filter-SET MS6-LFM-3/8-ARV (530519)
  • Micro filter-SET MS6-LFM-3/8-ARV-Z (530521)
  • Micro filter-SET MS6-LFM-3/8-AUV (529757)
  • Micro filter-SET MS6-LFM-3/8-AUV-Z (529758)
  • Micro filter-SET MS6N-LFM-1/2-ARM (531897)
  • Micro filter-SET MS6N-LFM-1/2-ARV (531903)
  • Mini slide DGSL-16-100-Y3A (544003)
  • Mini slide DGSL-16-10-PA (543983)
  • Mini slide DGSL-16-150-Y3A (544004)
  • Mini slide DGSL-16-20-PA (543984)
  • Mini slide DGSL-16-30-PA (543985)
  • Mini slide DGSL-16-40-PA (543986)
  • Mini slide DGSL-16-50-PA (543987)
  • Mini slide DGSL-16-50-Y3A (544001)
  • Mini slide DGSL-16-80-Y3A (544002)
  • Mini slide DGSL-20-100-Y3A (544027)
  • Mini slide DGSL-20-10-PA (544005)
  • Mini slide DGSL-20-150-Y3A (544028)
  • Mini slide DGSL-20-200-Y3A (544029)
  • Mini slide DGSL-20-20-PA (544006)
  • Mini slide DGSL-20-30-PA (544007)
  • Mini slide DGSL-20-40-PA (544008)
  • Mini slide DGSL-20-50-PA (544009)
  • Mini slide DGSL-20-50-Y3A (544025)
  • Mini slide DGSL-20-80-Y3A (544026)
  • Mounting plate 2846102-0200 (8046570)
  • Mounting plate 2878267-0200 A3/CF (8049039)
  • Mounting plate 2986743-0200 (8049040)
  • Mounting plate 3108445-0002_TK/OR/PPF/Z/1/000 (4060393)
  • Mounting plate 3406543-1 (8058539)
  • Mounting plate 3406546-0101 FLAP HEATER (8058376)
  • Mounting plate CMKA (8188412)
  • Pin clamp cylinder DFAU-50-...-CS (8203452)
  • Pin clamp cylinder ITLUB-50-14,5-60-P-A-CS (8199156)
  • Pin clamp cylinder ITLUB-50-15,5-60-P-A-CS (8199208)
  • Pin clamp cylinder ITLUB-50-17,5-60-P-A-CS (8199213)
  • Pin clamp cylinder ITLUB-50-19,5-60-P-A-CS (8199221)
  • Planar surface gantry EXCH-40- (1923050)
  • Planar surface gantry EXCH-60- (1939785)
  • Planar surface gantry EXCM-40- (3741955)
  • Planar surface gantry YXMF-2 (8082253)
  • Planar surface gantry YXMF-3 (8082254)
  • plug connector NPQH-D-Q10-E-P10 (578326)
  • plug connector NPQH-D-Q12-E-P10 (578327)
  • plug connector NPQH-D-Q12-Q8-P10 (578331)
  • plug connector NPQH-D-Q14-E-P10 (578328)
  • plug connector NPQH-D-Q14-Q10-P10 (578332)
  • plug connector NPQH-D-Q14-Q12-P10 (578333)
  • plug connector NPQH-D-Q4-E-P10 (578323)
  • plug connector NPQH-D-Q6-E-P10 (578324)
  • plug connector NPQH-D-Q6-Q4-P10 (578329)
  • plug connector NPQH-D-Q8-E-P10 (578325)
  • plug connector NPQH-D-Q8-Q6-P10 (578330)
  • plug connector NPQH-D-S10-Q4-P10 (578307)
  • plug connector NPQH-D-S10-Q6-P10 (578308)
  • plug connector NPQH-D-S10-Q8-P10 (578309)
  • plug connector NPQH-D-S12-Q10-P10 (578312)
  • plug connector NPQH-D-S12-Q6-P10 (578310)
  • plug connector NPQH-D-S12-Q8-P10 (578311)
  • plug connector NPQH-D-S14-Q10-P10 (578315)
  • plug connector NPQH-D-S14-Q12-P10 (578316)
  • plug connector NPQH-D-S14-Q6-P10 (578313)
  • plug connector NPQH-D-S14-Q8-P10 (578314)
  • plug connector NPQH-D-S6-Q4-P10 (578304)
  • plug connector NPQH-D-S8-Q4-P10 (578305)
  • plug connector NPQH-D-S8-Q6-P10 (578306)
  • Plug screw NPQH-BK-G12-P10 (578409)
  • Plug screw NPQH-BK-G14-P10 (578407)
  • Plug screw NPQH-BK-G18-P10 (578406)
  • Plug screw NPQH-BK-G38-P10 (578408)
  • Plug screw NPQH-BK-M5-P10 (578404)
  • Plug screw NPQH-BK-M7-P10 (578405)
  • Pneumatic Drive Assembly ADNH-80-CS (8188637)
  • Pneumatic module D:PAL-MECH-12-P-BG-II. RED. (8023837)
  • Pneumatic module D:PAL-MECH-12-P-BG-II. (8022248)
  • Pneumatic module D:PAL-MECH-12-P-BG-II. (8067704)
  • Pressure booster DPA-40-16-SA (568942)
  • proximity switch SME-10M-DS-24V-E-0,3-L-M8D (551367)
  • Push-in bulkhead connector NPQH-H-Q10-E-P10 (578302)
  • Push-in bulkhead connector NPQH-H-Q12-E-P10 (578303)
  • Push-in bulkhead connector NPQH-H-Q4-E-P10 (578299)
  • Push-in bulkhead connector NPQH-H-Q6-E-P10 (578300)
  • Push-in bulkhead connector NPQH-H-Q8-E-P10 (578301)
  • Push-in fitting NPQH-D-G12-Q10-P10 (578349)
  • Push-in fitting NPQH-D-G12-Q12-P10 (578350)
  • Push-in fitting NPQH-D-G12-Q14-P10 (578351)
  • Push-in fitting NPQH-D-G12-S12-P10 (578369)
  • Push-in fitting NPQH-D-G14F-Q4-P10 (578355)
  • Push-in fitting NPQH-D-G14F-Q6-P10 (578356)
  • Push-in fitting NPQH-D-G14F-Q8-P10 (578357)
  • Push-in fitting NPQH-D-G14-Q10-P10 (578343)
  • Push-in fitting NPQH-D-G14-Q12-P10 (578344)
  • Push-in fitting NPQH-D-G14-Q6-P10 (578341)
  • Push-in fitting NPQH-D-G14-Q8-P10 (578342)
  • Push-in fitting NPQH-D-G14-S10-P10 (578365)
  • Push-in fitting NPQH-D-G14-S12-P10 (578366)
  • Push-in fitting NPQH-D-G14-S6-P10 (578363)
  • Push-in fitting NPQH-D-G14-S8-P10 (578364)
  • Push-in fitting NPQH-D-G18F-Q4-P10 (578352)
  • Push-in fitting NPQH-D-G18F-Q6-P10 (578353)
  • Push-in fitting NPQH-D-G18F-Q8-P10 (578354)
  • Push-in fitting NPQH-D-G18-Q4-P10 (578338)
  • Push-in fitting NPQH-D-G18-Q6-P10 (578339)
  • Push-in fitting NPQH-D-G18-Q8-P10 (578340)
  • Push-in fitting NPQH-D-G18-S4-P10 (578360)
  • Push-in fitting NPQH-D-G18-S6-P10 (578361)
  • Push-in fitting NPQH-D-G18-S8-P10 (578362)
  • Push-in fitting NPQH-D-G38-Q10-P10 (578346)
  • Push-in fitting NPQH-D-G38-Q12-P10 (578347)
  • Push-in fitting NPQH-D-G38-Q14-P10 (578348)
  • Push-in fitting NPQH-D-G38-Q8-P10 (578345)
  • Push-in fitting NPQH-D-G38-S10-P10 (578367)
  • Push-in fitting NPQH-D-G38-S12-P10 (578368)
  • Push-in fitting NPQH-DK-G14-Q10-P10 (578378)
  • Push-in fitting NPQH-DK-G14-Q8-P10 (578377)
  • Push-in fitting NPQH-DK-G18-Q10-P10 (8114985)
  • Push-in fitting NPQH-DK-G18-Q4-P10 (578374)
  • Push-in fitting NPQH-DK-G18-Q6-P10 (578375)
  • Push-in fitting NPQH-DK-G18-Q8-P10 (578376)
  • Push-in fitting NPQH-DK-G38-Q12-P10 (578379)
  • Push-in fitting NPQH-DK-M5-Q4-P10 (578370)
  • Push-in fitting NPQH-DK-M5-Q6-P10 (8114987)
  • Push-in fitting NPQH-DK-M7-Q4-P10 (578372)
  • Push-in fitting NPQH-DK-M7-Q6-P10 (8114986)
  • Push-in fitting NPQH-D-M5-Q4-P10 (578334)
  • Push-in fitting NPQH-D-M5-Q6-P10 (578335)
  • Push-in fitting NPQH-D-M5-S4-P10 (578358)
  • Push-in fitting NPQH-D-M5-S6-P10 (578359)
  • Push-in fitting NPQH-D-M7-Q4-P10 (578336)
  • Push-in fitting NPQH-D-M7-Q6-P10 (578337)
  • Push-in L-connector NPQH-L-Q10-E-P10 (578273)
  • Push-in L-connector NPQH-L-Q12-E-P10 (578274)
  • Push-in L-connector NPQH-L-Q14-E-P10 (578275)
  • Push-in L-connector NPQH-L-Q4-E-P10 (578270)
  • Push-in L-connector NPQH-L-Q6-E-P10 (578271)
  • Push-in L-connector NPQH-L-Q8-E-P10 (578272)
  • Push-in L-fitting NPQH-L-G12-Q10-P10 (578291)
  • Push-in L-fitting NPQH-L-G12-Q12-P10 (578292)
  • Push-in L-fitting NPQH-L-G12-Q14-P10 (578293)
  • Push-in L-fitting NPQH-L-G14-Q10-P10 (578285)
  • Push-in L-fitting NPQH-L-G14-Q12-P10 (578286)
  • Push-in L-fitting NPQH-L-G14-Q6-P10 (578283)
  • Push-in L-fitting NPQH-L-G14-Q8-P10 (578284)
  • Push-in L-fitting NPQH-L-G18-Q4-P10 (578280)
  • Push-in L-fitting NPQH-L-G18-Q6-P10 (578281)
  • Push-in L-fitting NPQH-L-G18-Q8-P10 (578282)
  • Push-in L-fitting NPQH-L-G38-Q10-P10 (578288)
  • Push-in L-fitting NPQH-L-G38-Q12-P10 (578289)
  • Push-in L-fitting NPQH-L-G38-Q14-P10 (578290)
  • Push-in L-fitting NPQH-L-G38-Q8-P10 (578287)
  • Push-in L-fitting NPQH-L-M5-Q4-P10 (578276)
  • Push-in L-fitting NPQH-L-M5-Q6-P10 (578277)
  • Push-in L-fitting NPQH-L-M7-Q4-P10 (578278)
  • Push-in L-fitting NPQH-L-M7-Q6-P10 (578279)
  • Push-in L-fitting, long NPQH-LL-G14-Q10-P10 (578268)
  • Push-in L-fitting, long NPQH-LL-G14-Q6-P10 (578266)
  • Push-in L-fitting, long NPQH-LL-G14-Q8-P10 (578267)
  • Push-in L-fitting, long NPQH-LL-G18-Q4-P10 (578263)
  • Push-in L-fitting, long NPQH-LL-G18-Q6-P10 (578264)
  • Push-in L-fitting, long NPQH-LL-G18-Q8-P10 (578265)
  • Push-in L-fitting, long NPQH-LL-G38-Q10-P10 (578269)
  • Push-in sleeve NPQH-D-S10-E-P10 (578320)
  • Push-in sleeve NPQH-D-S12-E-P10 (578321)
  • Push-in sleeve NPQH-D-S14-E-P10 (578322)
  • Push-in sleeve NPQH-D-S4-E-P10 (578317)
  • Push-in sleeve NPQH-D-S6-E-P10 (578318)
  • Push-in sleeve NPQH-D-S8-E-P10 (578319)
  • Push-in T-connector NPQH-T-Q10-E-P10 (578383)
  • Push-in T-connector NPQH-T-Q10-Q8-P10 (578388)
  • Push-in T-connector NPQH-T-Q12-E-P10 (578384)
  • Push-in T-connector NPQH-T-Q12-Q10-P10 (578389)
  • Push-in T-connector NPQH-T-Q14-E-P10 (578385)
  • Push-in T-connector NPQH-T-Q4-E-P10 (578380)
  • Push-in T-connector NPQH-T-Q6-E-P10 (578381)
  • Push-in T-connector NPQH-T-Q6-Q4-P10 (578386)
  • Push-in T-connector NPQH-T-Q8-E-P10 (578382)
  • Push-in T-connector NPQH-T-Q8-Q6-P10 (578387)
  • Push-in T-fitting NPQH-T-G12-Q10-P10 (578402)
  • Push-in T-fitting NPQH-T-G12-Q12-P10 (578403)
  • Push-in T-fitting NPQH-T-G14-Q10-P10 (578397)
  • Push-in T-fitting NPQH-T-G14-Q12-P10 (578398)
  • Push-in T-fitting NPQH-T-G14-Q6-P10 (578395)
  • Push-in T-fitting NPQH-T-G14-Q8-P10 (578396)
  • Push-in T-fitting NPQH-T-G18-Q4-P10 (578392)
  • Push-in T-fitting NPQH-T-G18-Q6-P10 (578393)
  • Push-in T-fitting NPQH-T-G18-Q8-P10 (578394)
  • Push-in T-fitting NPQH-T-G38-Q10-P10 (578400)
  • Push-in T-fitting NPQH-T-G38-Q12-P10 (578401)
  • Push-in T-fitting NPQH-T-G38-Q8-P10 (578399)
  • Push-in T-fitting NPQH-T-M5-Q4-P10 (578390)
  • Push-in T-fitting NPQH-T-M5-Q6-P10 (578391)
  • Push-in Y-connector NPQH-Y-Q10-E-P10 (578412)
  • Push-in Y-connector NPQH-Y-Q10-Q8-P10 (578415)
  • Push-in Y-connector NPQH-Y-Q6-E-P10 (578410)
  • Push-in Y-connector NPQH-Y-Q6-Q4-P10 (578413)
  • Push-in Y-connector NPQH-Y-Q8-E-P10 (578411)
  • Push-in Y-connector NPQH-Y-Q8-Q6-P10 (578414)
  • Service unit combination MSB6-1/2:C1J1D1A1F3-WP (530183)
  • Service unit combination MSB6-1/2:C1J1F3M1-WP (530185)
  • Service unit combination MSB6-1/2:C1J1F3-WP (530184)
  • Service unit combination MSB6-1/2:C1J1M1D1A1F3-WP (530187)
  • Service unit combination MSB6-1/2:C1J1M1-WP (530186)
  • Service unit combination MSB6-1/2:C1J1-WP (530182)
  • Service unit combination MSB6-1/2:C1J2D1A1F3-WP (530189)
  • Service unit combination MSB6-1/2:C1J2F3M1-WP (530191)
  • Service unit combination MSB6-1/2:C1J2F3-WP (530190)
  • Service unit combination MSB6-1/2:C1J2M1D1A1F3-WP (530193)
  • Service unit combination MSB6-1/2:C1J2M1-WP (530192)
  • Service unit combination MSB6-1/2:C1J2M1-WP-BSEN (538968)
  • Service unit combination MSB6-1/2:C1J2-WP (530188)
  • Service unit combination MSB6-1/2:C1J2-WP-BSEN (538965)
  • Service unit combination MSB6-1/2:C1J3D1A1F3-WP (530195)
  • Service unit combination MSB6-1/2:C1J3F3M1-WP (530197)
  • Service unit combination MSB6-1/2:C1J3F3-WP (530196)
  • Service unit combination MSB6-1/2:C1J3M1D1A1F3-WP (530199)
  • Service unit combination MSB6-1/2:C1J3M1-WP (530198)
  • Service unit combination MSB6-1/2:C1J3-WP (530194)
  • Service unit combination MSB6-1/2:C1J4D1A1F3-WP (530201)
  • Service unit combination MSB6-1/2:C1J4F3M1-WP (530203)
  • Service unit combination MSB6-1/2:C1J4F3-WP (530202)
  • Service unit combination MSB6-1/2:C1J4M1D1A1F3-WP (530205)
  • Service unit combination MSB6-1/2:C1J4M1-WP (530204)
  • Service unit combination MSB6-1/2:C1J4-WP (530200)
  • Service unit combination MSB6-1/2:C3:J1:D14-WP (8025359)
  • Service unit combination MSB6-1/2:C3:J1:F12-WP (8025357)
  • Service unit combination MSB6-1/2:C3:J1:F1-WP (8233022)
  • Service unit combination MSB6-1/2:C3:J120:D14-WP (8042670)
  • Service unit combination MSB6-1/2:C3:J120:F12-WP (8042671)
  • Service unit combination MSB6-1/2:C3:J120-WP (8042672)
  • Service unit combination MSB6-1/2:C3:J1-WP (8025355)
  • Service unit combination MSB6-1/2:C3:J6-*:T (546869)
  • Service unit combination MSB6-1/2:C3J1D1A1F3-WP (542269)
  • Service unit combination MSB6-1/2:C3J1D7A1F3-WP (542635)
  • Service unit combination MSB6-1/2:C3J1F3M1-WP (542271)
  • Service unit combination MSB6-1/2:C3J1F3-WP (542270)
  • Service unit combination MSB6-1/2:C3J1M1D1A1F3-WP (542273)
  • Service unit combination MSB6-1/2:C3J1M1D7A1F3-WP (542636)
  • Service unit combination MSB6-1/2:C3J1M1-WP (542272)
  • Service unit combination MSB6-1/2:C3J1-WP (542268)
  • Service unit combination MSB6-1/2:C3J2D1A1F3-WP (542275)
  • Service unit combination MSB6-1/2:C3J2D7A1F3-WP (542637)
  • Service unit combination MSB6-1/2:C3J2F3M1-WP (542277)
  • Service unit combination MSB6-1/2:C3J2F3-WP (542276)
  • Service unit combination MSB6-1/2:C3J2M1D1A1F3-WP (542279)
  • Service unit combination MSB6-1/2:C3J2M1D7A1F3-WP (542638)
  • Service unit combination MSB6-1/2:C3J2M1-WP (542278)
  • Service unit combination MSB6-1/2:C3J2M1-WP-BSEN (542321)
  • Service unit combination MSB6-1/2:C3J2-WP (542274)
  • Service unit combination MSB6-1/2:C3J2-WP-BSEN (542318)
  • Service unit combination MSB6-1/2:C3J3D1A1F3-WP (542281)
  • Service unit combination MSB6-1/2:C3J3D7A1F3-WP (542639)
  • Service unit combination MSB6-1/2:C3J3F3M1-WP (542283)
  • Service unit combination MSB6-1/2:C3J3F3-WP (542282)
  • Service unit combination MSB6-1/2:C3J3M1D1A1F3-WP (542285)
  • Service unit combination MSB6-1/2:C3J3M1D7A1F3-WP (542640)
  • Service unit combination MSB6-1/2:C3J3M1-WP (542284)
  • Service unit combination MSB6-1/2:C3J3-WP (542280)
  • Service unit combination MSB6-1/2:C3J4D1A1F3-WP (542287)
  • Service unit combination MSB6-1/2:C3J4D7A1F3-WP (542641)
  • Service unit combination MSB6-1/2:C3J4F3M1-WP (542289)
  • Service unit combination MSB6-1/2:C3J4F3-WP (542288)
  • Service unit combination MSB6-1/2:C3J4M1D1A1F3-WP (542291)
  • Service unit combination MSB6-1/2:C3J4M1D7A1F3-WP (542642)
  • Service unit combination MSB6-1/2:C3J4M1-WP (542290)
  • Service unit combination MSB6-1/2:C3J4-WP (542286)
  • Service unit combination MSB6-1/2:F8:C4:J3:F8-WP (8150998)
  • Service unit combination MSB6-1/2:H1N2M1-WP (530206)
  • Service unit combination MSB6-1/2:H1N2M1-WP-Z (530207)
  • Service unit combination MSB6-1/2:H1N3M1-WP (530208)
  • Service unit combination MSB6-1/2:H1N3M1-WP-Z (530209)
  • Service unit combination MSB6-1/2:H2N2M1-WP (530212)
  • Service unit combination MSB6-1/2:H2N2M1-WP-Z (530213)
  • Service unit combination MSB6-1/2:H2N3M1-WP (530214)
  • Service unit combination MSB6-1/2:H2N3M1-WP-Z (530215)
  • Service unit combination MSB6-1/2:H3N3M1-WP (530218)
  • Service unit combination MSB6-1/2:H3N3M1-WP-Z (530219)
  • Service unit combination MSB6-1/2:H4N3M1-WP (530220)
  • Service unit combination MSB6-1/2:H4N3M1-WP-Z (530221)
  • Service unit combination MSB6-1/2:H7N3M2-WP (530210)
  • Service unit combination MSB6-1/2:H7N3M2-WP-Z (530211)
  • Service unit combination MSB6-1/2:H8N3M2-WP (530216)
  • Service unit combination MSB6-1/2:H8N3M2-WP-Z (530217)
  • Service unit combination MSB6-1/2:J1:F3-WP (8233023)
  • Service unit combination MSB6-1/2:J1:M1-WP (8233024)
  • Service unit combination MSB6-1/2:J120:M1-WP (8233026)
  • Service unit combination MSB6-1/2:J121:M1-WP (8233027)
  • Service unit combination MSB6-1/2:J1D1A1-WP (530222)
  • Service unit combination MSB6-1/2:J1D7A1-WP (542643)
  • Service unit combination MSB6-1/2:J1M1D1A1-WP (530223)
  • Service unit combination MSB6-1/2:J1M1D7A1-WP (542644)
  • Service unit combination MSB6-1/2:J2D1A1-WP (530224)
  • Service unit combination MSB6-1/2:J2D7A1-WP (542645)
  • Service unit combination MSB6-1/2:J2M1D1A1-WP (530225)
  • Service unit combination MSB6-1/2:J2M1D7A1-WP (542646)
  • Service unit combination MSB6-1/2:J3D1A1-WP (530226)
  • Service unit combination MSB6-1/2:J3D7A1-WP (542647)
  • Service unit combination MSB6-1/2:J3M1D1A1-WP (530227)
  • Service unit combination MSB6-1/2:J3M1D7A1-WP (542648)
  • Service unit combination MSB6-1/2:J4:M1 (8233028)
  • Service unit combination MSB6-1/2:J4D1A1-WP (530228)
  • Service unit combination MSB6-1/2:J4D7A1-WP (542649)
  • Service unit combination MSB6-1/2:J4M1D1A1-WP (530229)
  • Service unit combination MSB6-1/2:J4M1D7A1-WP (542650)
  • Service unit combination MSB6-1/2-FRC1:J5M1 (530230)
  • Service unit combination MSB6-1/2-FRC1:J5M1-Z (530231)
  • Service unit combination MSB6-1/2-FRC10:J12M2 (530232)
  • Service unit combination MSB6-1/2-FRC10:J12M2-Z (530233)
  • Service unit combination MSB6-1/2-FRC11:J9M2 (530234)
  • Service unit combination MSB6-1/2-FRC11:J9M2-Z (530235)
  • Service unit combination MSB6-1/2-FRC12:J10M2 (530236)
  • Service unit combination MSB6-1/2-FRC12:J10M2-Z (530237)
  • Service unit combination MSB6-1/2-FRC13:J120M1 (8042673)
  • Service unit combination MSB6-1/2-FRC2:J6M1 (530238)
  • Service unit combination MSB6-1/2-FRC2:J6M1-Z (530239)
  • Service unit combination MSB6-1/2-FRC3:J7M1 (530240)
  • Service unit combination MSB6-1/2-FRC3:J7M1-Z (530241)
  • Service unit combination MSB6-1/2-FRC4:J8M1 (530242)
  • Service unit combination MSB6-1/2-FRC4:J8M1-Z (530243)
  • Service unit combination MSB6-1/2-FRC5:J1M1 (530244)
  • Service unit combination MSB6-1/2-FRC5:J1M1-Z (530245)
  • Service unit combination MSB6-1/2-FRC6:J2M1 (530246)
  • Service unit combination MSB6-1/2-FRC6:J2M1-Z (530247)
  • Service unit combination MSB6-1/2-FRC7:J3M1 (530248)
  • Service unit combination MSB6-1/2-FRC7:J3M1-Z (530249)
  • Service unit combination MSB6-1/2-FRC8:J4M1 (530250)
  • Service unit combination MSB6-1/2-FRC8:J4M1-Z (530251)
  • Service unit combination MSB6-1/2-FRC9:J11M2 (530252)
  • Service unit combination MSB6-1/2-FRC9:J11M2-Z (530253)
  • Service unit combination MSB6-1/4:C1J2M1-WP-BSEN (538967)
  • Service unit combination MSB6-1/4:C1J2-WP-BSEN (538964)
  • Service unit combination MSB6-1/4:C3:J1:D1:A1:F3-WP (8233029)
  • Service unit combination MSB6-1/4:C3:J1-WP (8233030)
  • Service unit combination MSB6-1/4:C3J2M1-WP-BSEN (542320)
  • Service unit combination MSB6-1/4:C3J2-WP-BSEN (542317)
  • Service unit combination MSB6-1/4:J2:M1-WP (8233031)
  • Service unit combination MSB6-1/4-FRC1:J5M1 (530254)
  • Service unit combination MSB6-1/4-FRC1:J5M1-Z (530255)
  • Service unit combination MSB6-1/4-FRC10:J12M2 (530256)
  • Service unit combination MSB6-1/4-FRC10:J12M2-Z (530257)
  • Service unit combination MSB6-1/4-FRC11:J9M2 (530258)
  • Service unit combination MSB6-1/4-FRC11:J9M2-Z (530259)
  • Service unit combination MSB6-1/4-FRC12:J10M2 (530260)
  • Service unit combination MSB6-1/4-FRC12:J10M2-Z (530261)
  • Service unit combination MSB6-1/4-FRC2:J6M1 (530262)
  • Service unit combination MSB6-1/4-FRC2:J6M1-Z (530263)
  • Service unit combination MSB6-1/4-FRC3:J7M1 (530264)
  • Service unit combination MSB6-1/4-FRC3:J7M1-Z (530265)
  • Service unit combination MSB6-1/4-FRC4:J8M1 (530266)
  • Service unit combination MSB6-1/4-FRC4:J8M1-Z (530267)
  • Service unit combination MSB6-1/4-FRC5:J1M1 (530268)
  • Service unit combination MSB6-1/4-FRC5:J1M1-Z (530269)
  • Service unit combination MSB6-1/4-FRC6:J2M1 (530270)
  • Service unit combination MSB6-1/4-FRC6:J2M1-Z (530271)
  • Service unit combination MSB6-1/4-FRC7:J3M1 (530272)
  • Service unit combination MSB6-1/4-FRC7:J3M1-Z (530273)
  • Service unit combination MSB6-1/4-FRC8:J4M1 (530274)
  • Service unit combination MSB6-1/4-FRC8:J4M1-Z (530275)
  • Service unit combination MSB6-1/4-FRC9:J11M2 (530276)
  • Service unit combination MSB6-1/4-FRC9:J11M2-Z (530277)
  • Service unit combination MSB6-3/8:C3:J1:D1:A1:F3-WP (8233032)
  • Service unit combination MSB6-3/8:C3:J1:F3-WP (8233033)
  • Service unit combination MSB6-3/8:C3:J1-WP (8233034)
  • Service unit combination MSB6-3/8:C3:J2:F3-WP (8233035)
  • Service unit combination MSB6-3/8:C3:J2-WP (8233036)
  • Service unit combination MSB6-3/8:I2:I4 (8233037)
  • Service unit combination MSB6-3/8:J2:F3-WP (8233038)
  • Service unit combination MSB6-3/8:J2:M1-WP (8233039)
  • Service unit combination MSB6-3/8-FRC1:J5M1 (530278)
  • Service unit combination MSB6-3/8-FRC1:J5M1-Z (530279)
  • Service unit combination MSB6-3/8-FRC10:J12M2 (530280)
  • Service unit combination MSB6-3/8-FRC10:J12M2-Z (530281)
  • Service unit combination MSB6-3/8-FRC11:J9M2 (530282)
  • Service unit combination MSB6-3/8-FRC11:J9M2-Z (530283)
  • Service unit combination MSB6-3/8-FRC12:J10M2 (530284)
  • Service unit combination MSB6-3/8-FRC12:J10M2-Z (530285)
  • Service unit combination MSB6-3/8-FRC2:J6M1 (530286)
  • Service unit combination MSB6-3/8-FRC2:J6M1-Z (530287)
  • Service unit combination MSB6-3/8-FRC3:J7M1 (530288)
  • Service unit combination MSB6-3/8-FRC3:J7M1-Z (530289)
  • Service unit combination MSB6-3/8-FRC4:J8M1 (530290)
  • Service unit combination MSB6-3/8-FRC4:J8M1-Z (530291)
  • Service unit combination MSB6-3/8-FRC5:J1M1 (530292)
  • Service unit combination MSB6-3/8-FRC5:J1M1-Z (530293)
  • Service unit combination MSB6-3/8-FRC6:J2M1 (530294)
  • Service unit combination MSB6-3/8-FRC6:J2M1-Z (530295)
  • Service unit combination MSB6-3/8-FRC7:J3M1 (530296)
  • Service unit combination MSB6-3/8-FRC7:J3M1-Z (530297)
  • Service unit combination MSB6-3/8-FRC8:J4M1 (530298)
  • Service unit combination MSB6-3/8-FRC8:J4M1-Z (530299)
  • Service unit combination MSB6-3/8-FRC9:J11M2 (530300)
  • Service unit combination MSB6-3/8-FRC9:J11M2-Z (530301)
  • Service unit combination MSB6-AGC:TEPA1-WP (538427)
  • Service unit combination MSB6-AGD:C4:J1:F6-WP (8143543)
  • Service unit combination MSB6-AGD:C4:N3:F6-WP (8143542)
  • Service unit combination MSB6-AGE:C3:J1-WP (8233040)
  • Service unit combination MSB6-AGE:C3:J2-WP (8233041)
  • Service unit combination MSB6-AGE:J1:F3-WP (8233042)
  • Service unit combination MSB6-AGE:J1:M1 (8233043)
  • Service unit combination MSB6-AGE:J1:M1-WP (8233044)
  • Service unit combination MSB6-AGE:J121:M1-WP (8233045)
  • Service unit combination MSB6-AGE:J2:M1 (8233046)
  • Service unit combination MSB6-AGE:J2:M1-WP (8233047)
  • Service unit combination MSB6-AGF:J1:M1-WP (8233048)
  • Service unit combination MSB6-AGF:J120:M1-WP (8233049)
  • Service unit combination MSB6-AGF:J121:M1-WP (8233050)
  • Service unit combination MSB6-AGF:J2:M1-WP (8233051)
  • Service unit combination WART.GER.-KOMB (8123718)
  • Service unit combination WART.GER.-KOMB (8135683)
  • Service unit 3492350-0001 (8109104)
  • Service unit MS6-EM1FR-1/2-D6-C-P-M-A8-WPE-B (8130912)
  • Service unit MS6-EM1FR-1/2-D6-C-P-M-A8-WP-F1A-B (8176531)
  • Service unit MS6-EM1FR-1/2-D6-C-P-M-AG-BAR-WPE-B (8098363)
  • Service unit MS6-EM1FR-1/2-D6-C-P-M-AG-BAR-WP-F1A-B (8176527)
  • Service unit MS6-EM1FR-1/2-D6-C-P-M-AG-MPA-WPE-B (8098371)
  • Service unit MS6-EM1FR-1/2-D6-C-P-M-AG-MPA-WP-F1A-B (8176528)
  • Service unit MS6-EM1FR-1/2-D6-C-P-VC-A8-WPE-B (8130911)
  • Service unit MS6-EM1FR-1/2-D6-C-P-VC-AG-BAR-WPE-B (8098370)
  • Service unit MS6-EM1FR-1/2-D6-C-P-VC-AG-MPA-WPE-B (8098368)
  • Service unit MS6-EM1FR-1/2-D6-E-P-M-A8-WPE-B (8130913)
  • Service unit MS6-EM1FR-1/2-D6-E-P-M-A8-WP-F1A-B (8176532)
  • Service unit MS6-EM1FR-1/2-D6-E-P-M-AG-BAR-WPE-B (8098365)
  • Service unit MS6-EM1FR-1/2-D6-E-P-M-AG-BAR-WP-F1A-B (8176529)
  • Service unit MS6-EM1FR-1/2-D6-E-P-M-AG-MPA-WPE-B (8098369)
  • Service unit MS6-EM1FR-1/2-D6-E-P-M-AG-MPA-WP-F1A-B (8176530)
  • Service unit MS6-EM1FR-1/2-D6-E-P-VC-A8-WPE-B (8130914)
  • Service unit MS6-EM1FR-1/2-D6-E-P-VC-AG-BAR-WPE-B (8098367)
  • Service unit MS6-EM1FR-1/2-D6-E-P-VC-AG-MPA-WPE-B (8098364)
  • Service unit MSB6 (531030)
  • Service unit MSB6-1/2:C3:J1:F1:D14-WP (8211574)
  • Service unit MSB6-1/2:C3:J1:V55-WP (8220359)
  • Service unit MSB6-1/2:C3:J1:V74-WP (8220360)
  • Service unit MSB6-1/2:C3:J2:V22-WP (8210067)
  • Service unit MSB6-1/2:C3:J81:F1:D19:F1-WP-UL1 (8194151)
  • Service unit MSB6-1/2:C3:J82:D19:F1-WP (8184070)
  • Service unit MSB6-1/2:C4:J1:A1-WP (8225113)
  • Service unit MSB6-1/2:C4:J1:D20:F8-WP (8224587)
  • Service unit MSB6-1/2:C4:J1:F12-WP (8215865)
  • Service unit MSB6-1/2:C4:J1:F1-WP (8233313)
  • Service unit MSB6-1/2:C4:J1:F2-WP (8235001)
  • Service unit MSB6-1/2:C4:J1:V37:F1-WP (8179404)
  • Service unit MSB6-1/2:C4:J10:D4:A1:F10-WPB (8210991)
  • Service unit MSB6-1/2:C4:J10:F10-WPB (8210992)
  • Service unit MSB6-1/2:C4:J10:V22:I8-WP (8172783)
  • Service unit MSB6-1/2:C4:J11-WP (8183109)
  • Service unit MSB6-1/2:C4:J126:F1:V35:F8-WP (8200013)
  • Service unit MSB6-1/2:C4:J126:F1:V38-WPB (8236503)
  • Service unit MSB6-1/2:C4:J126:F1:V39:F8-WP (8228572)
  • Service unit MSB6-1/2:C4:J127-WP (8228576)
  • Service unit MSB6-1/2:C4:J16:F1:V8-WPB (8167951)
  • Service unit MSB6-1/2:C4:J1-WP (8235002)
  • Service unit MSB6-1/2:C4:J2:M1-WP (8217454)
  • Service unit MSB6-1/2:C4:J3:F15:V5:F1-WPB-UL1 (8206484)
  • Service unit MSB6-1/2:C4:J3:F6:V5:F1-WPB-UL1 (8187584)
  • Service unit MSB6-1/2:C4:J3:V1:F1-WPB (8166046)
  • Service unit MSB6-1/2:C4:J3:V35:F10-WP (8171185)
  • Service unit MSB6-1/2:C4:J3:V35:F17-WP (8166541)
  • Service unit MSB6-1/2:C4:J3-WP (8171186)
  • Service unit MSB6-1/2:C4:J4:D4:A1-WP (8208326)
  • Service unit MSB6-1/2:C4:J5:F1:V38-WPB (8224734)
  • Service unit MSB6-1/2:C4:J5:V35:F17-WP (8207386)
  • Service unit MSB6-1/2:C4:J5B:D20:F8:V72:F1-WP (8224790)
  • Service unit MSB6-1/2:C4:J5B:F1:V72:F1-WP (8224791)
  • Service unit MSB6-1/2:C4:J5B:V22-WP (8219607)
  • Service unit MSB6-1/2:C4:J6:A1-WP (8206960)
  • Service unit MSB6-1/2:C4:J6:F17-WP (8215484)
  • Service unit MSB6-1/2:C4:J7:V39-WP (8176281)
  • Service unit MSB6-1/2:C4:J8:F1:V74-WP-UL1 (8219708)
  • Service unit MSB6-1/2:C4:J81:F1:D20:F1-WP-UL1 (8189272)
  • Service unit MSB6-1/2:C4:J81:F1:V65:F1-WPB (8210474)
  • Service unit MSB6-1/2:C4:J9:F1-WP (8173146)
  • Service unit MSB6-1/2:C4:J91-WP (8189589)
  • Service unit MSB6-1/2:C4:J97B-WP (8193517)
  • Service unit MSB6-1/2:C4:M1:N2-WP (8225114)
  • Service unit MSB6-1/2:C4:W1:J119-WP (8225115)
  • Service unit MSB6-1/2:C6:J9:F1:V37:F15-WPB-UL1 (8224845)
  • Service unit MSB6-1/2:C6:J9:F1:V37:F15-WP-UL1 (8224849)
  • Service unit MSB6-1/2:C6:J9:F1:V39:F17-WPB-UL1 (8224846)
  • Service unit MSB6-1/2:C6:J9:F1:V47:F15-WPB (8224847)
  • Service unit MSB6-1/2:C6:J9:V37:F15-WP-UL1 (8224848)
  • Service unit MSB6-1/2:C7:H1:I25:I26:N2:L3:F12-WP (8236886)
  • Service unit MSB6-1/2:D1B:J6B:F1-WP (8199500)
  • Service unit MSB6-1/2:F1:C4:V39:F1-WP-UL1 (8182126)
  • Service unit MSB6-1/2:F1:V37:F15-WP-UL1 (8224850)
  • Service unit MSB6-1/2:F1:V39:F1-WP-UL1 (8182127)
  • Service unit MSB6-1/2:J1:I1:I3-WP (8180970)
  • Service unit MSB6-1/2:J4:V22-WP (8189265)
  • Service unit MSB6-1/2:J7:I5:F6:V37-WPB (8174661)
  • Service unit MSB6-1/2:W1:J3:O5:N2:F17:O1-WPB (8198842)
  • Service unit MSB6-3/8:C4:J1:F3:D8:A1-WP (8212240)
  • Service unit MSB6-3/8:C4:J11-WP-Z (8183032)
  • Service unit MSB6-3/8:C4:J5-WP (8176479)
  • Service unit MSB6-3/8:J5:B4-WP (8176481)
  • Service unit MSB6-AGB:C4:J12:V66:F1-WPB (8204462)
  • Service unit MSB6-AGC:C4:J8-WP-UL1 (8233923)
  • Service unit MSB6-AGD:C4:J102:F1:V39:F1-WPB (8171967)
  • Service unit MSB6-AGD:C4:J102:F1:V41:F1-WPB (8171966)
  • Service unit MSB6-AGD:C4:J2:F1:V8-WPB (8179403)
  • Service unit MSB6-AGD:C4:J6:F6:U7:M1:D8:V37-WP (8218584)
  • Service unit MSB6-AGD:C4:J6:M1:F6:D8:V37-WP (8204976)
  • Service unit MSB6-AGD:C4:J79:A1:F1-WP (8193153)
  • Service unit MSB6-AGD:C4:J79:F1:V12:F12-WP (8212825)
  • Service unit MSB6-AGD:C4:J85:F1:V70-WP (8243461)
  • Service unit MSB6-AGD:C4:J90:F1:V48:F1-WPB (8165922)
  • Service unit MSB6-AGD:C4:J90:F10:V48:F10-WPB (8171187)
  • Service unit MSB6-AGD:C4:V39:F10-WP-UL1 (8235405)
  • Service unit MSB6-AGD:C4:V53-WP (8193154)
  • Service unit MSB6-AGD:C4:V54-WP (8208289)
  • Service unit MSB6-AGD:C7:H6:W1-WP (8232318)
  • Service unit MSB6-AGD:C7:J90:F1:U9:F1:V39-WPB (8201254)
  • Service unit MSB6-AGD:C7:J94:F14:V61-WP (8231816)
  • Service unit MSB6-AGD:C7:J94:F14:V63-WPB (8231819)
  • Service unit MSB6-AGD:C7:J94:F14:V74-WP (8231818)
  • Service unit MSB6-AGD:F14:V39:F14-WP-UL1 (8182125)
  • Service unit MSB6-AGD:H3:I10:I5:G7-WP (8193157)
  • Service unit MSB6-AGD:H3:I10:I5-WP (8193155)
  • Service unit MSB6-AGD:H4:N3:M1-WP (8221913)
  • Service unit MSB6-AGD:H4:N52:M1-WP (8232314)
  • Service unit MSB6-AGD:J7:F1:C4:V39:F6-WP (8228936)
  • Service unit MSB6-AGD:V35:F1-WPB (8201587)
  • Service unit MSB6-AGD:V39:F1-WPB (8171968)
  • Service unit MSB6-AGE:C4:F3-WPB-UL1 (8213724)
  • Service unit MSB6-AGE:C4:H3:I23:U10:N62-WP (8194238)
  • Service unit MSB6-AGE:C4:J7:F12-WP (8168544)
  • Service unit MSB6-AGE:C4:V38:F3-WPB-UL1 (8234963)
  • Service unit MSB6-AQP:C4:J8:F15:V12-WP (8233929)
  • Service unit MSB6-AQP:C4:J8:F15:V12-WP-Z (8233922)
  • Service unit MSB6-AQP:C4:J8:F15:V39-WP-Z (8233928)
  • Service unit MSB6-AQP:C4:J85:I25:I26:L1-WP (8177484)
  • Service unit MSB6-AQP:C4:W1:D20:J6:H1:H4:F17-WP (8215485)
  • Service unit MSB6-AQP:J8:F15:V12-WP-Z (8233927)
  • Service unit MSB6-AQP:R1:C4:W1:I8-WPB-UL1-Z (8170397)
  • Service unit MSB6-AQR:C3:H4:I4:N2:F1:V36-WP (8168415)
  • Service unit MSB6-AQR:C4:D20:J6:F10-WP (8177292)
  • Service unit MSB6-AQR:C4:H4:N47:F12-WP (8177291)
  • Service unit MSB6-AQR:C4:J8:F15:V12-WP (8233924)
  • Service unit MSB6-AQR:C4:J8:V12-WP-Z (8233925)
  • Service unit MSB6-AQR:C4:J83 (8168068)
  • Service unit MSB6-AQR:C4:J85 (8177479)
  • Service unit MSB6-AQR:C4:J85:I25:I26:L1-WP (8177485)
  • Service unit MSB6-AQR:C4:J85:I26-WP (8177482)
  • Service unit MSB6-AQR:C4:V48:F1-WP (8200895)
  • Service unit MSB6-AQR:C7:H6:W1-WP (8233167)
  • Service unit MSB6-AQR:C7:J94:F14:V61-WP (8231815)
  • Service unit MSB6-AQR:C7:J94:F14:V63-WPB (8231820)
  • Service unit MSB6-AQR:C7:J94:F14:V74-WP (8231817)
  • Service unit MSB6-AQR:H4:N3:M1-WP (8221914)
  • Service unit MSB6-AQR:H4:N52:M1-WP (8232308)
  • Service unit MSB6-AQR:W1:C4:J6-WP (8206176)
  • Service unit MSB6-AQS:C4:H3:I25:I26:L3-WP (8223146)
  • Service unit MSB6-AQS:C4:H3:I25:I26:L3-WP-Z (8223154)
  • Service unit MSB6-AQS:C4:H3:I26-WP (8223143)
  • Service unit MSB6-AQS:C4:H3:I26-WP-Z (8223150)
  • Service unit MSB6-AQS:C4:J10:F15:V12-WP (8233926)
  • Service unit MSB6-AQS:C4:J81:I26-WP (8221293)
  • Set of components D:WS-MPS-SPAREPART-SET (8170329)
  • Solenoid valve VUVG-...T1 (575203)
  • Solenoid valve VUVG-B10-B52-ZT-F-1T1L (573418)
  • Solenoid valve VUVG-B10-B52-ZT-F-1T1L-EX2C (8041888)
  • Solenoid valve VUVG-B10-M52-MZT-F-1T1L (573417)
  • Solenoid valve VUVG-B10-M52-MZT-F-1T1L-EX2C (8041892)
  • Solenoid valve VUVG-B10-M52-RZT-F-1T1L (573416)
  • Solenoid valve VUVG-B10-M52-RZT-F-1T1L-EX2C (8041889)
  • Solenoid valve VUVG-B10-P53C-ZT-F-1T1L (573419)
  • Solenoid valve VUVG-B10-P53C-ZT-F-1T1L-EX2C (8041890)
  • Solenoid valve VUVG-B10-P53E-ZT-F-1T1L (573420)
  • Solenoid valve VUVG-B10-P53E-ZT-F-1T1L-EX2C (8041894)
  • Solenoid valve VUVG-B10-P53U-ZT-F-1T1L (573421)
  • Solenoid valve VUVG-B10-P53U-ZT-F-1T1L-EX2C (8041893)
  • Solenoid valve VUVG-B10-T32C-AZT-F-1T1L (573410)
  • Solenoid valve VUVG-B10-T32C-AZT-F-1T1L-EX2C (8041895)
  • Solenoid valve VUVG-B10-T32C-MZT-F-1T1L (573413)
  • Solenoid valve VUVG-B10-T32C-MZT-F-1T1L-EX2C (8041891)
  • Solenoid valve VUVG-B10-T32H-AZT-F-1T1L (573412)
  • Solenoid valve VUVG-B10-T32H-AZT-F-1T1L-EX2C (8041897)
  • Solenoid valve VUVG-B10-T32H-MZT-F-1T1L (573415)
  • Solenoid valve VUVG-B10-T32H-MZT-F-1T1L-EX2C (8041899)
  • Solenoid valve VUVG-B10-T32U-AZT-F-1T1L (573411)
  • Solenoid valve VUVG-B10-T32U-AZT-F-1T1L-EX2C (8041896)
  • Solenoid valve VUVG-B10-T32U-MZT-F-1T1L (573414)
  • Solenoid valve VUVG-B10-T32U-MZT-F-1T1L-EX2C (8041898)
  • Solenoid valve VUVG-B10Z-M32C-RZT-F-1T1L (8028231)
  • Solenoid valve VUVG-B10Z-M32C-RZT-F-1T1L-EX2C (8041900)
  • Solenoid valve VUVG-B10Z-M32U-RZT-F-1T1L (8028232)
  • Solenoid valve VUVG-B10Z-M32U-RZT-F-1T1L-EX2C (8041901)
  • Solenoid valve VUVG-B14-B52-ZT-F-1T1L (573484)
  • Solenoid valve VUVG-B14-B52-ZT-F-1T1L-EX2C (8041966)
  • Solenoid valve VUVG-B14-M52-AZT-F-1T1L (573482)
  • Solenoid valve VUVG-B14-M52-AZT-F-1T1L-EX2C (8041964)
  • Solenoid valve VUVG-B14-M52-MZT-F-1T1L (573483)
  • Solenoid valve VUVG-B14-M52-MZT-F-1T1L-EX2C (8041965)
  • Solenoid valve VUVG-B14-P53C-ZT-F-1T1L (573485)
  • Solenoid valve VUVG-B14-P53C-ZT-F-1T1L-EX2C (8041967)
  • Solenoid valve VUVG-B14-P53E-ZT-F-1T1L (573486)
  • Solenoid valve VUVG-B14-P53E-ZT-F-1T1L-EX2C (8041968)
  • Solenoid valve VUVG-B14-P53U-ZT-F-1T1L (573487)
  • Solenoid valve VUVG-B14-P53U-ZT-F-1T1L-EX2C (8041969)
  • Solenoid valve VUVG-B14-T32C-AZT-F-1T1L (573476)
  • Solenoid valve VUVG-B14-T32C-AZT-F-1T1L-EX2C (8041958)
  • Solenoid valve VUVG-B14-T32C-MZT-F-1T1L (573479)
  • Solenoid valve VUVG-B14-T32C-MZT-F-1T1L-EX2C (8041961)
  • Solenoid valve VUVG-B14-T32H-AZT-F-1T1L (573478)
  • Solenoid valve VUVG-B14-T32H-AZT-F-1T1L-EX2C (8041960)
  • Solenoid valve VUVG-B14-T32H-MZT-F-1T1L (573481)
  • Solenoid valve VUVG-B14-T32H-MZT-F-1T1L-EX2C (8041963)
  • Solenoid valve VUVG-B14-T32U-AZT-F-1T1L (573477)
  • Solenoid valve VUVG-B14-T32U-AZT-F-1T1L-EX2C (8041959)
  • Solenoid valve VUVG-B14-T32U-MZT-F-1T1L (573480)
  • Solenoid valve VUVG-B14-T32U-MZT-F-1T1L-EX2C (8041962)
  • Solenoid valve VUVG-B14Z-M32C-AZT-F-1T1L (8028235)
  • Solenoid valve VUVG-B14Z-M32C-AZT-F-1T1L-EX2C (8041970)
  • Solenoid valve VUVG-B14Z-M32U-AZT-F-1T1L (8028236)
  • Solenoid valve VUVG-B14Z-M32U-AZT-F-1T1L-EX2C (8041971)
  • Solenoid valve VUVG-B18-B52-ZT-F-1T1L (8004893)
  • Solenoid valve VUVG-B18-M52-MZT-F-1T1L (8004892)
  • Solenoid valve VUVG-B18-M52-RZT-F-1T1L (8004891)
  • Solenoid valve VUVG-B18-P53C-ZT-F-1T1L (8004894)
  • Solenoid valve VUVG-B18-P53E-ZT-F-1T1L (8004895)
  • Solenoid valve VUVG-B18-P53U-ZT-F-1T1L (8004896)
  • Solenoid valve VUVG-B18-T32C-AZT-F-1T1L (8004885)
  • Solenoid valve VUVG-B18-T32C-MZT-F-1T1L (8004888)
  • Solenoid valve VUVG-B18-T32H-AZT-F-1T1L (8004887)
  • Solenoid valve VUVG-B18-T32H-MZT-F-1T1L (8004890)
  • Solenoid valve VUVG-B18-T32U-AZT-F-1T1L (8004886)
  • Solenoid valve VUVG-B18-T32U-MZT-F-1T1L (8004889)
  • Solenoid valve VUVG-S10-B52-ZT-M5-1T1L (573394)
  • Solenoid valve VUVG-S10-B52-ZT-M7-1T1L (573406)
  • Solenoid valve VUVG-S10-M52-MZT-M5-1T1L (573393)
  • Solenoid valve VUVG-S10-M52-MZT-M7-1T1L (573405)
  • Solenoid valve VUVG-S10-M52-RZT-M5-1T1L (573392)
  • Solenoid valve VUVG-S10-M52-RZT-M7-1T1L (573404)
  • Solenoid valve VUVG-S10-P53C-ZT-M5-1T1L (573395)
  • Solenoid valve VUVG-S10-P53C-ZT-M7-1T1L (573407)
  • Solenoid valve VUVG-S10-P53E-ZT-M5-1T1L (573396)
  • Solenoid valve VUVG-S10-P53E-ZT-M7-1T1L (573408)
  • Solenoid valve VUVG-S10-P53U-ZT-M5-1T1L (573397)
  • Solenoid valve VUVG-S10-P53U-ZT-M7-1T1L (573409)
  • Solenoid valve VUVG-S10-T32C-AZT-M5-1T1L (573386)
  • Solenoid valve VUVG-S10-T32C-AZT-M7-1T1L (573398)
  • Solenoid valve VUVG-S10-T32C-MZT-M5-1T1L (573389)
  • Solenoid valve VUVG-S10-T32C-MZT-M7-1T1L (573401)
  • Solenoid valve VUVG-S10-T32H-AZT-M5-1T1L (573388)
  • Solenoid valve VUVG-S10-T32H-AZT-M7-1T1L (573400)
  • Solenoid valve VUVG-S10-T32H-MZT-M5-1T1L (573391)
  • Solenoid valve VUVG-S10-T32H-MZT-M7-1T1L (573403)
  • Solenoid valve VUVG-S10-T32U-AZT-M5-1T1L (573387)
  • Solenoid valve VUVG-S10-T32U-AZT-M7-1T1L (573399)
  • Solenoid valve VUVG-S10-T32U-MZT-M5-1T1L (573390)
  • Solenoid valve VUVG-S10-T32U-MZT-M7-1T1L (573402)
  • Solenoid valve VUVG-S14-B52-ZT-G18-1T1L (573472)
  • Solenoid valve VUVG-S14-M52-AZT-G18-1T1L (573470)
  • Solenoid valve VUVG-S14-M52-MZT-G18-1T1L (573471)
  • Solenoid valve VUVG-S14-P53C-ZT-G18-1T1L (573473)
  • Solenoid valve VUVG-S14-P53E-ZT-G18-1T1L (573474)
  • Solenoid valve VUVG-S14-P53U-ZT-G18-1T1L (573475)
  • Solenoid valve VUVG-S14-T32C-AZT-G18-1T1L (573464)
  • Solenoid valve VUVG-S14-T32C-MZT-G18-1T1L (573467)
  • Solenoid valve VUVG-S14-T32H-AZT-G18-1T1L (573466)
  • Solenoid valve VUVG-S14-T32H-MZT-G18-1T1L (573469)
  • Solenoid valve VUVG-S14-T32U-AZT-G18-1T1L (573465)
  • Solenoid valve VUVG-S14-T32U-MZT-G18-1T1L (573468)
  • Solenoid valve VUVG-S18-B52-ZT-G14-1T1L (8004881)
  • Solenoid valve VUVG-S18-M52-MZT-G14-1T1L (8004880)
  • Solenoid valve VUVG-S18-M52-RZT-G14-1T1L (8004879)
  • Solenoid valve VUVG-S18-P53C-ZT-G14-1T1L (8004882)
  • Solenoid valve VUVG-S18-P53E-ZT-G14-1T1L (8004883)
  • Solenoid valve VUVG-S18-P53U-ZT-G14-1T1L (8004884)
  • Solenoid valve VUVG-S18-T32C-AZT-G14-1T1L (8004873)
  • Solenoid valve VUVG-S18-T32C-MZT-G14-1T1L (8004876)
  • Solenoid valve VUVG-S18-T32H-AZT-G14-1T1L (8004875)
  • Solenoid valve VUVG-S18-T32H-MZT-G14-1T1L (8004878)
  • Solenoid valve VUVG-S18-T32U-AZT-G14-1T1L (8004874)
  • Solenoid valve VUVG-S18-T32U-MZT-G14-1T1L (8004877)
  • supply module 3224105-0203 (8121525)
  • supply module 3224105-0204 (8132311)
  • valve control unit VPC-P4M2-M5-CS (8185214)
  • Valve terminal SET 3394173-0100_AC (8073652)
  • Valve terminal SET 3394173-1_AC (8121388)
  • Valve terminal SET D:PAL-MECH-12-VENT-SET-VTUG (8022232)
  • Valve terminal 004877.0.0_VTUG-S-SM (8084060)
  • Valve terminal 014781.1.0_VTUG-S-SM (8084059)
  • Valve terminal 014986.0.0_VTUG-S-SM (8084058)
  • Valve terminal 07L0356873H (8069714)
  • Valve terminal 07L0356874A (8069713)
  • Valve terminal 07L0374889E (8072408)
  • Valve terminal 07L0450395H (8094743)
  • Valve terminal 07L0485049G (8102918)
  • Valve terminal 07L0666264B (8158616)
  • Valve terminal 07L0755252D (8188964)
  • Valve terminal 11051258-VTUG-10-ROBOTERR7-HNBR (8090342)
  • Valve terminal 11073716-VTUG-HUELSENLADER-HNBR (8094971)
  • Valve terminal 11114204-VTUG-10-EINGANGSPALTTE (8095507)
  • Valve terminal 11214218-VTUG-10-R70-HNBR (8154225)
  • Valve terminal 11214230-VTUG-14-R70-HNBR (8154227)
  • Valve terminal 11215468-VTUG-10-R70-HNBR (8154226)
  • Valve terminal 11215481-VTUG-14-R70-HNBR (8154228)
  • Valve terminal 2-041-80-4990 (8082018)
  • Valve terminal 2-242-95-0010 (8025161)
  • Valve terminal 2-242-95-00202-242-95-0020 (8025162)
  • Valve terminal 2-242-95-0030 (8025163)
  • Valve terminal 2-242-95-0040 (8025164)
  • Valve terminal 2-242-95-0050 (8025165)
  • Valve terminal 2-242-95-0060 (8025166)
  • Valve terminal 2-242-95-0070 (8025167)
  • Valve terminal 32E-MPM+GA | 32P-TFK-R-MA-3JL (8221403)
  • Valve terminal 32E-MPM+HA | 32P-SFD-N-MA-MMJJ (8217758)
  • Valve terminal 32E-MPM+K32P-SGL-R-M6B-12J (8156418)
  • Valve terminal 32E-MPM-E+D32P-SGL-R-M3AU-12K (8170591)
  • Valve terminal 34974351-MPA-C MS1...7MS (8082746)
  • Valve terminal 34P-API-E-U4AEBU-6J (8190896)
  • Valve terminal 34P-API-U16AU-15KL (8224738)
  • Valve terminal 34P-API-U16AU-JJ14M (8224741)
  • Valve terminal 34P-API-U8AU-6GKK (8224739)
  • Valve terminal 34P-API-U9AU-5MDJMJ (8224742)
  • Valve terminal 34P-API-UAATS12AU-MKGG10K (8224740)
  • Valve terminal 34P-CX-CD-U6B-5JKPGT50E-F36GCQPIXERERERERER-L (8168550)
  • Valve terminal 34P-CX-CD-U6B-5JNPGT50E-F36GCQPERERERER-L (8176285)
  • Valve terminal 34P-CX-CD-UBB-DPHTD50E-F36GCQPERNIX-L (8168548)
  • Valve terminal 34P-CX-CD-UBB-JJ50E-F36GCQPER-L (8176286)
  • Valve terminal 34P-CX-CD-UBB-JJ50E-F36GCQPIXERERER-L (8168549)
  • Valve terminal 34P-CX-DEBC-U5FEFT9E-5MKM8KG+TM50E-F44GCQS-L-D+UI2GJ (8188805)
  • Valve terminal 34P-CX-DEBC-U7ETEE3F3EFEE-9K3MGGKMKK-UL1+TM50E-F44GCQS-L-D+UI2GJ (8188804)
  • Valve terminal 34P-CX-SD-U4EZ-4M-UL1 | 50E-F40GCQSNMKD-L+NBA (8210230)
  • Valve terminal 34P-CX-SD-U4EZ-4M-UL1 | 50E-F40GCQSNMKDUX-L+NBA (8210236)
  • Valve terminal 34P-CX-SD-U4FZ-4M-UL1 | 50E-F14GAQSNMKB-L+N (8210237)
  • Valve terminal 34P-CX-SD-UEE-MM-UL1 | 50E-F40GCQSFX-L+N (8210233)
  • Valve terminal 34P-CX-SD-UEE-MM-UL1 | 50E-F40GCQSNMKD-L+N (8210234)
  • Valve terminal 34P-CX-SFEJCMCDM-3BAUA-4JW50E-F36GCQRDRDR-L (8176343)
  • Valve terminal 34P-CX-SFEJCMCDM-3BAUA-4JW50E-F43GCQRDRDR-L (8176342)
  • Valve terminal 34P-CX-SFEJCMCDM-3BAUAA-4JWJ50E-F36GCQRTXDRDR-L (8176344)
  • Valve terminal 34P-CX-SFEJCMM-UAKO6A-ME5J50E-F36GCQRT25GJDRDRDRDR-L (8176345)
  • Valve terminal 34P-CX-SFEJCMM-UAKOAV17Q17AV17Q17AV17Q17AV17Q17AV17Q17A-ME5J50E-F36GCQRT25GJDRDRDRDR-L (8176347)
  • Valve terminal 34P-CX-SFEJCMM-UAKOAV17Q17AV17Q17AV17Q17AV17Q17AV17Q17A-ME5J50E-F43GCQRT25GJDRDRDRDR-L (8176346)
  • Valve terminal 34P-CX-SFEJCM-UAV17Q17AV17Q17AV17Q17AV17Q17-4J50E-F36GCQRDRDR-L (8176348)
  • Valve terminal 34P-CX-SFEJCM-UBKERLERBKERLER-JJ50E-F36GCQRDRDR-L (8176352)
  • Valve terminal 34P-CX-SFEJCRCDM-BUA-EW50E-F36GCQRDRDR-L (8176353)
  • Valve terminal 34P-CX-SFEJCRCDM-BUA-JW50E-F36GCQRDRDR-L (8176354)
  • Valve terminal 34P-CX-SFEJGCD-BUBA-EEM50E-F36GCQRDRDRDR-L (8176355)
  • Valve terminal 34P-CX-U4A-GGMM50E-F36GCQPER-L (8168551)
  • Valve terminal 34P-CX-U4ETR4EZEEU-10M-UL1 | 50E-F14GAQSEX-L+NBA (8210232)
  • Valve terminal 34P-CX-U4ETR4EZEEU-10M-UL1 | 50E-F40GCQSEX-L+NBA (8210235)
  • Valve terminal 34P-CX-U4ETR4EZEEU-10M-UL1 | 50E-F40GCQSNMKD-L+NBA (8210231)
  • Valve terminal 34P-LK-5AU-3LKL (8230856)
  • Valve terminal 34P-LK-AB-AAU5AU3ATSUAKCGLCGAKCGLCGAKCGLCG-LL5K3L3M (8237720)
  • Valve terminal 34P-LK-CD-U7B-GGKS4L (8187193)
  • Valve terminal 34P-LK-E-U4ATZU4AZ-8M-UL1 (8197614)
  • Valve terminal 34P-LK-E-U4AZ-4M-UL1 (8197613)
  • Valve terminal 34P-LK-E-U4AZ-M3J-UL1 (8197612)
  • Valve terminal 34P-LK-E-UAA-JJ-UL1 (8197608)
  • Valve terminal 34P-LK-E-UAATUAA-4J-UL1 (8197609)
  • Valve terminal 34P-LK-E-UAATUAA-4M-UL1 (8197615)
  • Valve terminal 34P-LK-KBG-U6AU-6M (8236011)
  • Valve terminal 34P-LK-N-UEETSBKGLDGBELCG3EU-KKMPFT3KGM (8202966)
  • Valve terminal 34P-LK-SDEAB-U14C-6MS8L (8214962)
  • Valve terminal 34P-LK-SDEAB-U20C-6MS3L3MS8L (8214963)
  • Valve terminal 34P-LK-SGEJCGCD-UKFG8BTBUKFG-GGKSKS5L (8187194)
  • Valve terminal 34P-LK-STCQ-U8BU-3JPFT3JME (8186489)
  • Valve terminal 34P-LK-STCQ-U9BU-JJEPFTJMPHTMPHTJJL (8186487)
  • Valve terminal 34P-LK-STCQ-UBKTGLTG8BU-JJPFT3JPFT3JL (8186488)
  • Valve terminal 34P-LK-STUHKUEAJBL-ULUE3ECKLGLLGCKLGLLG16CULUE-3KMPFVDMPFVDMPFVDMPFVDMPFVDMPFVDMPFVDMPFVD10M (8204007)
  • Valve terminal 34P-LK-U6A-6M (8230830)
  • Valve terminal 34P-LK-U6AU-6M (8230854)
  • Valve terminal 34P-LK-UAA-MJ-UL1 (8197611)
  • Valve terminal 34P-LK-UA-K-UL1 (8197610)
  • Valve terminal 34P-LK-UE-AAU5AU3ATSU3A-LL5K3L3M (8236880)
  • Valve terminal 34P-LK-UE-AAU5AU3ATSUAA-LL5K3LMM (8235222)
  • Valve terminal 34P-LK-UE-AAU5AU3ATSUAA-LL8KMM (8230813)
  • Valve terminal 34P-MS1-BC-UEFKOFEKDGLDGEKDGLDGFKOLDGFKDGLDGFKOEU-KMMHPVFDGHPVFDGMPVFDGMPVFDGMK+HDD (8227888)
  • Valve terminal 34P-MS1-U4AZU-GGLL (8189264)
  • Valve terminal 34P-MS6-5AU-3LKL (8230857)
  • Valve terminal 34P-MS6-SF-UEE-DD+CE (8199505)
  • Valve terminal 34P-MS6-U4FZFFU-6MS+CR (8197622)
  • Valve terminal 34P-MS6-U6A-6M (8230836)
  • Valve terminal 34P-MS8-DNGLGMGCD-U7B-GGKS4L:SM (8166885)
  • Valve terminal 34P-PT-SGDELGMGJCGCD-UKFG8BTBUKFG-GGKSKS5L (8196759)
  • Valve terminal 35P-MS1-JBG-N-EWBEFKOJCGFWBTPKCGJCGEPVNDGETPFPVTPKONDGFFKOJCGEWB-GKMMHH3MG-EN+FB (8198358)
  • Valve terminal 35P-MS1-JBG-N-EWBEFKOJCGFWBTPKCGJCGEPVNDGETPFPVTPKONDGFFKOJCGEWB-KKMMHH3MK-EN+FB (8198862)
  • Valve terminal 35P-MS1-SDUGBC-JGG-EWBETSKDG4EWB-MM4K+FAY (611389)
  • Valve terminal 35P-MS1-SGBGGZRDRE-N-EWBEWB-MM+FAY (8186513)
  • Valve terminal 35P-MS3-SGBGG-N-FWBKCMJCREKCMJCRFKCMJCRFKCMJCREKCMJCREWBKDMJCRFKCMJCRETPKCMJCREPVTPEPVTPLGGMGGEPVLGGMGGEWBTPKCMJCR4F-MKMMKKMKE3K4L+FG (8203469)
  • Valve terminal 35P-PT-SFBCMZ-EWB5EUNGGLGGMGG6EWB-J11M+FIY (8186512)
  • Valve terminal 35P-PT-SGBGGZ-N-EWBTP3EWB3EWB-7L-EN+FI (8186514)
  • Valve terminal 5054051 VTUG 3 DYNESTIC (8144501)
  • Valve terminal 5068683-VTUG-GRM-IO-LINK (8157475)
  • Valve terminal 5068688-VTUG-FINISH-IO-LINK (8157479)
  • Valve terminal 5068690-VTUG-FINISH-IO-LINK (8157480)
  • Valve terminal 5068704-VTUG-FINISH-IO-LINK (8157481)
  • Valve terminal 5068705-VTUG-GRM (8157477)
  • Valve terminal 5068710-VTUG-FINISH (8157478)
  • Valve terminal 5068714-VTUG-FINISH (8157476)
  • Valve terminal 5068993-VTUG-FINISH-IO-LINK (8157482)
  • Valve terminal 50E-F11GBQS-D+HI32P-VGL-R-MAABU-10J (8187935)
  • Valve terminal 50E-F11GBQS-D+HI32P-VGL-R-MPEB5AU-20JLL (8187934)
  • Valve terminal 50E-F13GEQP-D-E+GS32P-SGL-R-MAHAHAHU-12K (8160934)
  • Valve terminal 50E-F13GEQPERERERERERER-D-E+GS | 32P-SGL-R-MAHAHAHUAHAHAHU-24K (8160969)
  • Valve terminal 50E-F13GEQPERERERERERERER-D-E+2GS | 32P-SGL-R-MAHAHAHUAHLAHAHUAHAHU-32K (8170590)
  • Valve terminal 50E-F13GEQPERERERERERERER-D-E+GS | 32P-SGL-R-MAHAHAHUAHAHAHAHU-28K (8160971)
  • Valve terminal 50E-F13GEQPERERERERERERERER-D-E+2GS | 32P-SGL-R-MAHAHAHUAHLAHAHUAHAHU-32K (8170589)
  • Valve terminal 50E-F13GFQS-D-UL1+NBE | 32P-SCD-R-MQX-QE+K (8203007)
  • Valve terminal 50E-F33GCQP-D-E+GS2GZ | 32P-SGL-R-MAHAHAHAHU-16K (8160970)
  • Valve terminal 50E-F33GCQP-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHU-24K (8160972)
  • Valve terminal 50E-F33GCQP-D-E+GS2GZ | 32P-SGL-R-MAHAHUAHAHAHU-20K (8160973)
  • Valve terminal 50E-F33GCQP-D-UL1-EX1E+BE32P-SGK-R-MAHAHAHAHU-16K (8186932)
  • Valve terminal 50E-F33GCQPERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHAHU-16K (8160979)
  • Valve terminal 50E-F33GCQPERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHU-24K (8160980)
  • Valve terminal 50E-F33GCQPERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHUAHAHAHU-20K (8160982)
  • Valve terminal 50E-F33GCQPERERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHAHU-28K (8160983)
  • Valve terminal 50E-F33GCQPERERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHU-24K (8160984)
  • Valve terminal 50E-F33GCQPERERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHUAHAHAHU-20K (8160985)
  • Valve terminal 50E-F33GCQPERERERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHAHU-28K (8160986)
  • Valve terminal 50E-F33GCQPERERERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHU-24K (8160987)
  • Valve terminal 50E-F33GCQPERERERERERERER-D-E+2GS2GZ | 32P-SGL-R-MAHAHAHUAHLAHAHUAHAHU-32K (8170588)
  • Valve terminal 50E-F33GCQPERERERERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHAHU-28K (8160989)
  • Valve terminal 50E-F33GCQPERERERERERERERER-D-E+2GS2GZ | 32P-SGL-R-MAHAHAHUAHLAHAHUAHAHU-32K (8160988)
  • Valve terminal 50E-F33GCQPEXLXIW-D-UL1-EX1E+BE32P-SGK-R-MAHAHAHAH-16K (8187348)
  • Valve terminal 50E-F36GCQP-D32P-SCQ-N-MAHAHAHULQX-12KSQB (8197595)
  • Valve terminal 50E-F36GCQP-D-E | 32P-SFK-M8QXL5QX-13QE (8234961)
  • Valve terminal 50E-F36GCQP-D-E | 32P-SFK-M8QXL8QX-16QD (8234962)
  • Valve terminal 50E-F36GCQP-D-UL1 | 32P-SFK-M8QXL5QX-13QE (8213848)
  • Valve terminal 50E-F36GCQP-D-UL1 | 32P-SFK-M8QXL8QX-16QD (8213847)
  • Valve terminal 50E-F36GCQPER-D32P-SGL-R-MQZAHIU-QBEEKL (8176278)
  • Valve terminal 50E-F36GCQPERERERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHU-24K (8170586)
  • Valve terminal 50E-F36GCQPERERERERERERER-D-E+GS2GZ | 32P-SGL-R-MAHAHAHUAHAHAHAHU-28K (8170587)
  • Valve terminal 50E-F36GCQPEREREXNIXLXZR2VL6-D32P-SGL-R-MLBHBHBHQZBHULQZBHU-GPFTGPFTJPFTEDDQBEEQBEE (8176279)
  • Valve terminal 50E-F36GCQPNIX-D+U32P-SGL-R-MQZAHIU-QBE3L (8176280)
  • Valve terminal 50E-F36GCQPTXNMKDNLGQ-D+UBA32P-SGL-N-MBHTVL3LAH-JJMMJL (8178206)
  • Valve terminal 50E-F36GCQRDRDR-D+BA32P-SNQ-R-MAA-8K (8187276)
  • Valve terminal 50E-F36GCQRDRDRNLGWPXPXPXIXIX-D+BA32P-SNQ-R-MAA-8K (8187275)
  • Valve terminal 50E-F36GCQS-D | 32P-SJQ-R-MPEE3QX-3KLQBQBQD (8234952)
  • Valve terminal 50E-F36GCQS-D+2NGZ | 32P-SFD-M6QXL6QX-12QD (8192586)
  • Valve terminal 50E-F36GCQS-D32P-XFL-R-MBHBHSVBHSVBHSWBHU-3KSLDSDSKSKSGG (8171272)
  • Valve terminal 50E-F36GCQSEBEBEB-D+HJ | 32P-SGL-R-M3BU3BU-12J (8237815)
  • Valve terminal 50E-F36GCQSEBEBEBER-D+HJ | 32P-SGL-R-MA-3JL (8237810)
  • Valve terminal 50E-F36GCQSEBEBEBERNLGWNLGW-D+HJ | 32P-SGL-R-MB-JJ (8237812)
  • Valve terminal 50E-F36GCQSEBEBERERERPGWPGWNLGWLGW-D+HJ | 32P-SGL-R-MBABAU-9J3L (8237809)
  • Valve terminal 50E-F36GCQSEBEBERERNLGW-D+HJ | 32P-SGL-R-MBBUBBU-7JL (8237816)
  • Valve terminal 50E-F36GCQSEBERERERPGWPGWNLGWLGW-D+HJ | 32P-SGL-R-MBAU-6J (8237808)
  • Valve terminal 50E-F36GCQSEBERERNLGWQZ-D+H2J | 32P-SGL-R-MBAU-4JLL (8237805)
  • Valve terminal 50E-F36GCQSEREREBEBERPGWNLGWNLGW-D+HJ | 32P-SGL-R-MA-3JL (8237807)
  • Valve terminal 50E-F36GCQSERERER-D+HJ | 32P-SGL-R-MAAU-JJB4JL (8237806)
  • Valve terminal 50E-F36GCQSEREREREBEBPGWNLGW-D+HJ | 32P-SGL-R-MB-JM (8237804)
  • Valve terminal 50E-F36GCQSERERERERER-D+HJ | 32P-SGL-R-M3BUAAU-5JBJJLL3JL (8237813)
  • Valve terminal 50E-F36GCQSERERERERERER-D-E+NGZ | 32P-SGL-R-M3AU3AU-24K (8170592)
  • Valve terminal 50E-F36GCQSERERERERERERER-D-E+NGZ | 32P-SGL-R-M3AU4AU-28K (8170593)
  • Valve terminal 50E-F36GCQSERERERNLGWNLGW-D+HJ | 32P-SGL-R-MA-M3J (8237811)
  • Valve terminal 50E-F36GCQSERERNLGW-D+HJ | 32P-SGL-R-MA-MMLL (8237814)
  • Valve terminal 50E-F36GCQSNYDRDRDRDRLRNIXNIX-D | 32P-TGK-D2-R-M3AL1LAHAHSL1LAHU-4KPFVE4DSKPGVEJV03Q10PFVEKLKKJLKKLJ4K (8206496)
  • Valve terminal 50E-F36GCQST12T12-D+5NGZ32P-SGL-N-MLAHLAHAHAHAHAHAHAHAHLAHAHTWLAHAHAHU-56L (8186917)
  • Valve terminal 50E-F36GCQST18-D+2N32P-SGL-N-ML1LAHAHAH-12L (8186915)
  • Valve terminal 50E-F36GCQST18-D+3N32P-SGL-N-ML1LAHL1LAHAH-12L (8186913)
  • Valve terminal 50E-F36GCQST18-D+3N32P-SGL-N-MLAHLAHAH-12L (8186969)
  • Valve terminal 50E-F36GCQST18-D+3NGZ32P-SGL-R-MLAHLAHAHAHAH-3KEE6GEE5GEE (8179397)
  • Valve terminal 50E-F37GCQP-D32P-SFK-R-MBHIIIUQXQX-GGQBQB (8191393)
  • Valve terminal 50E-F37GCQP-D32P-VGL-R-MAHAHAHAHU-3J12ML (8168413)
  • Valve terminal 50E-F37GCQP-D32P-VGL-R-MAHAHAHU-8JMMLL (8168414)
  • Valve terminal 50E-F37GCQP-D32P-VGL-R-MAHAHU-3J3MLL (8168412)
  • Valve terminal 50E-F37GCQP-D-UL132P-XGL-N-MAHUAHAHDYLBHBHBHBHU-KSG5KSG3KSL7GL (8187652)
  • Valve terminal 50E-F37GCQP-D-UL132P-XGL-N-MAHUAHAHSVLBHBHBHBHU-KSG5KSG3KSL7GL (8187567)
  • Valve terminal 50E-F37GCQP-D-UL132P-XGL-N-MAHUAHSVLBHBHBHBHU-KSG5KS8GL (8187568)
  • Valve terminal 50E-F37GCQSERER-D+NBA32P-SGL-R-MAHAHAHAHU-E4MSEMSEGE3MS3L (8172064)
  • Valve terminal 50E-F37GCQSERER-D+NBA32P-VGL-R-M3ASWBU-5MSG6MSKSKS (8172065)
  • Valve terminal 50E-F37GCQSERLR-D+NBA32P-SGL-R-M3AUASVBBU-MSGMSMSG4MSGMSMSG3MS4KS (8172061)
  • Valve terminal 50E-F37GCQSERMGQLR-D+NBA32P-VGL-R-MAHSWAHU-4MS3GL (8172063)
  • Valve terminal 50E-F37GCQSMGQMGQ-D+2NBA32P-VGL-R-MAHAHAHAHAHUAHAHAHSWL1LAHAHU-32G3E5MS (8172062)
  • Valve terminal 50E-F37GCQSNMKDLXTX-D+N | 32P-VGL-R-M3AU-10KLL+2T (8208360)
  • Valve terminal 50E-F37GCQSNMKDLXTX-D+N | 32P-VGL-R-MAAU-4GKKLL+2T (8208356)
  • Valve terminal 50E-F37GCQSNMKDLXTX-D+N | 32P-VGL-R-MAAU-6KLL+T (8208359)
  • Valve terminal 50E-F37GCQSNMKDLXTX-D+N | 32P-VGL-R-MAU-KKLL+T (8208358)
  • Valve terminal 50E-F37GCQSNMKDNMKD-D+N | 32P-VGL-R-M3AU-8G4L+2T (8208357)
  • Valve terminal 50E-F37GCQSNYUXLRLR-D | 32P-SGL-R-M3A-7MDSM3L+3Z (8200810)
  • Valve terminal 50E-F39GCQSNYNY-D-EX1E+NBE*32P-SCD-R-MAH3QX-MNGX3QC (8186936)
  • Valve terminal 50E-F40GCQRNYNY-D | 32P-SCD-R-MPEAHAHLAHAHSVPEAHAHSVPEAHAHSVPELAHAHQZUAH-6JLLEBEBEBEPGVEEPGVE5KSDSPFVELLJPFVEJPFVEJPFVEJPFVEJPFVEJPFVEJPFVEJPFVEEDSPFVEDSPFVEDSPFVEDSPFVED (8198120)
  • Valve terminal 50E-F40GCQSDRDRDRDRDRDRDRLR-D | 32P-TGK-R-MAALQZAHIAHUQZAHIAHULQZAHIAHAHAHU-KKJPHVEEE3KQEDSLDK4JQEDSLDK3JKQEDSLDK4JEEKKJPGVEJPGVELL+3K (8225219)
  • Valve terminal 50E-F43GCQP-D+4GS | 32P-SGL-N-M8QXL3L8QX-16QF (8200036)
  • Valve terminal 50E-F43GCQS-D+2M32P-XGL-R-MPEBHAHBHSVBHBHIIIUQXQXULAHBHSVBHBHIIIUQXQX-5MSLKSMS4GQBQB3MSLKSMS4GQBQB+12T4J (8192159)
  • Valve terminal 50E-F43GCQS-D+M32P-XGL-R-MBHAHBHSVBHBHIIIUQXQX-MSL3MSLKSMS4GQBQB+6T2J (8192160)
  • Valve terminal 50E-NMKBNMKBNMKBNMKBUKAQSF44GCQVLGWLGW-D+2M2GJ32P-SGL-R-MAH-3JL (8187587)
  • Valve terminal 51E-AKANMKBQAF43GCQB-D-UL132P-TGL-R-MBHBHBH-6J (8166048)
  • Valve terminal 51E-DKAF44GCQW-D | 32P-TGL-N-MQBH-ISJ (8201118)
  • Valve terminal 51E-F11GAQPNMKB-D32P-SGL-N-MBH-JL (8157158)
  • Valve terminal 51E-F11GAQPNMKBNMKB-D+GSBA32P-SCD-N-MBHBHBHBH-6JLL (8196532)
  • Valve terminal 51E-F11GAQPNMKBNMKB-D32P-SGL-N-MAHAH-5J3L (8157159)
  • Valve terminal 51E-F11GAQPNMKBNMKB-D32P-SGL-N-MAHAHAH-8J4L (8157160)
  • Valve terminal 51E-F11GAQPNMKDNMKDLX-D32P-SCD-N-MBHBHBH-6J (8196356)
  • Valve terminal 51E-F13GFQPLXQXAXAXAXAX-D+GSBA32P-SCD-N-MBH-LL (8196359)
  • Valve terminal 51E-F14GDQPLRLR-D+16CGS | 32P-SFL-N-MBHBHBHBH-5M3K (8233256)
  • Valve terminal 51E-F33GCQP-D+2GSGK | 32P-TGL-R-MBHBHBHBHBHBHBHBHL3LBHBHBHBH-21EKLL (8171184)
  • Valve terminal 51E-F33GCQP-D-E+GS2GZ | 32P-TGL-R-MBHBH-4KS (8177562)
  • Valve terminal 51E-F33GCQP-D-E+GS2GZ | 32P-TGL-R-MBHBHSVBHBH-8KS (8177561)
  • Valve terminal 51E-F36GCQPNMKB-D32P-SCD-N-MBHBH-3JL (8193152)
  • Valve terminal 51E-F36GCQPNMKBNMKB-D+GSBA32P-SCD-N-MBHBHBHBH-6JLL (8196358)
  • Valve terminal 51E-F39GCQPEKALKANIKATKANY-D+*32P-SCK-R-MAH-4M+T (8186933)
  • Valve terminal 51E-F39GCQPEKALKANIKATKANY-D+*32P-SCK-R-MAHQX-4MQC+2T (8186937)
  • Valve terminal 51E-F43GCQANMKBQBNMKB-D-UL1+BA | 32P-TGL-R-MBHBHUBHBHU-8J+2J (8216791)
  • Valve terminal 52E-AE8-X32P-SCK-R-MBB-EKEE (8196757)
  • Valve terminal 53E-F36GCQE3NB-D+VSBE | 32P-XGK-R-MAHAHTVAHTVAH-16KS+2T (8233311)
  • Valve terminal 53E-F36GCQE3NB-D+VSBE32P-XGK-R-MAHAHAHTVAHTVAHTVAH-24KS+6T (8182113)
  • Valve terminal 53E-F36GCQE4NB-D+VSBE | 32P-XGK-R-MAHAHAHAHTVAHTVAH-24KS+2T (8233312)
  • Valve terminal 53E-F36GCQENB-D+VSBE32P-XGK-R-MAHTVAH-8KS+2T (8182111)
  • Valve terminal 53E-F36GCQENBNB-D+VSBE32P-XGK-R-MAHAHTVAHTVAH-16KS+4T (8183096)
  • Valve terminal 53E-F36GCQENBNB-D+VSBE32P-XGK-R-MAHTVAHTVAHTVAH-16KS+4T (8182112)
  • Valve terminal 56E-CPI | 32P-VGL-R-MEEU-8K (8191149)
  • Valve terminal 56E-CPI32P-SGL-N-ML1AH-4L (8186916)
  • Valve terminal 56E-CPI32P-XCD-R-MAAU-8I (8174983)
  • Valve terminal 56E-CPI32P-XCD-R-MAAU-8J (8174984)
  • Valve terminal 7820-3202-850 VTUG (8165219)
  • Valve terminal 7820-3202-860 VTUG (8165215)
  • Valve terminal 7820-3320-360 VTUG (5177486)
  • Valve terminal 7820-3320-370 VTUG (5177121)
  • Valve terminal 7820-3320-800 VTUG (8119939)
  • Valve terminal 7820-3320-810 VTUG (8134731)
  • Valve terminal 7821-1731-040_MPAL-CS (8138599)
  • Valve terminal CDVI5.0 (197648)
  • Valve terminal HOLZ-HER 5063854 (8126740)
  • Valve terminal M05VI132-VTUG-18ALL-QM-GRLZ-PROFINET (8124705)
  • Valve terminal M05VI133-VTUG-9AL-QM-GRLZ-PROFINET (8124704)
  • Valve terminal MPA-ASI-VI (546279)
  • Valve terminal MPA-CPI-VI (546280)
  • Valve terminal MPAC-VI (575465)
  • Valve terminal MPA-FB-AP-VI (550808)
  • Valve terminal MPA-FB-VI (530411)
  • Valve terminal MPA-FB-VI-355797-CS (8165142)
  • Valve terminal MPA-FB-VI-357180-CS (8165167)
  • Valve terminal MPA-L 200 (8036532)
  • Valve terminal MPAL-VI (569926)
  • Valve terminal MPA-MPM-VI (539105)
  • Valve terminal MPA-MP-VI (533203)
  • Valve terminal PORTALWASCHANLAGE_BASIC (8084404)
  • Valve terminal PORTALWASCHANLAGE_BASIC+ER (8084405)
  • Valve terminal PORTALWASCHANLAGE_COMFORT (8084403)
  • Valve terminal PORTALWASCHANLAGE_COMFORT+ER (8084402)
  • Valve terminal PORTALWASCHANLAGE_COMPFORT+IX (8084401)
  • Valve terminal ROBOTER-R7-VTUG-14-11044507 (8092676)
  • Valve terminal SCM 12 VALVES PILOT P-ZONE 4+5 (8085466)
  • Valve terminal SMASS K16196 VTUG (8091023)
  • Valve terminal VMPAL-MP-DL-001 (574006)
  • Valve terminal VTUG BAZ7405 VI2 GESTELL (8028488)
  • Valve terminal VTUG VENTILINSEL "ROCKERVALVE" (4941798)
  • Valve terminal VTUG VRLK ST.INSEL (8VK) (8095567)
  • Valve terminal VTUG (573606)
  • Valve terminal VTUG_M10-CS (8116678)
  • Valve terminal VTUG10 VRLK 13P3L 2-242-95-6450 (8069546)
  • Valve terminal VTUG10 VRLK 8P 2-242-95-6440 (8069545)
  • Valve terminal VTUG-10-... (8038733)
  • Valve terminal VTUG-10-GR-B1T-G18-DT-M5S-10J (8189040)
  • Valve terminal VTUG-10-GR-B1T-G18-DT-M5S-16J (8189041)
  • Valve terminal VTUG-10-GR-B1T-G18-DT-M5S-20J4A (8188822)
  • Valve terminal VTUG-10-GR-B1T-G18-DT-M5S-20K (8189042)
  • Valve terminal VTUG-10-GR-B1T-G18-DT-M5S-4G4J (8189043)
  • Valve terminal VTUG-10-GR-B1T-G18-DT-M5S-4G8J (8189044)
  • Valve terminal VTUG-10-GR-B1T-G18-DT-M5S-4GAA5JVK (8189045)
  • Valve terminal VTUG-10-GR-B1TZ-G18-DT-M5S-5JTP4J4K3L (8189046)
  • Valve terminal VTUG-10-GR-B1TZ-G18-DT-M5S-8JGJJL (8189047)
  • Valve terminal VTUG-10-MRCR-B1H-50V26-Q8-U-Q6S-7VKJ4VKS3VKJVKGGTSJQ4JQ4JQ4JQ4+TT (8207252)
  • Valve terminal VTUG-10-MRCR-B1T-26V20-G18-DQ-CS-4A (8241097)
  • Valve terminal VTUG-10-MRCR-B1T-26V20-T14A-UL-T18S-LCCKKLCCLCCLCCTPACCXT532 (8243497)
  • Valve terminal VTUG-10-MSDR- -P3KPK3L+* (3838489)
  • Valve terminal VTUG-10-MSDR- -P4K4L+* (3838523)
  • Valve terminal VTUG-10-MSDR- -P5KPLL+* (3838268)
  • Valve terminal VTUG-10-MSDR-...-14PLL+* MPV.523 (8032445)
  • Valve terminal VTUG-10-MSDR-B1H-25V20-Q8-U-M5S-3AG4L (8199908)
  • Valve terminal VTUG-10-MSDR-B1H-25V20-Q8-U-M5S-4G8L (8199909)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10A-U-Q6S-4JTS4G+M2TT (8167068)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10A-U-Q6S-JJTR4G+M2TV (8170913)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10A-U-Q6S-JJTS4G+M2TV (8167070)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10BA-UL-M7SU-4J+M3TT (8167071)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10LA-UL-Q4S-4JQ6JQ6+M2TV (8167072)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10LA-UL-Q4S-9JQ6JQ6+M2TV (8167074)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10LA-UL-Q6S-4JE+M3TV (8167075)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10LA-UL-Q6S-5J+M3TV (8167076)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10LA-UL-Q6S-6J+M2TT (8184701)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10LA-UR-Q6S-3KJ+M3TT (8167077)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q4S-10J+M1TV (8170914)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q6S-4VK (8163395)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q6S-6JQ4JQ4JQ4JQ4 (8170915)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q6S-6JQ4JQ4JQ4JQ4+M2TT (8170916)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q6S-7J+M2TT (8170917)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q6S-7JL+M2TT (8170918)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q6S-8J+M2TT (8170919)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q6S-KQ4JQ4JJ+M3TT (8170920)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-UL-Q6S-KQ4KQ4GJ+M3TT (8167078)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-U-Q6S-4J+M3TT (8184702)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10L-U-QH6S-10G+M3TT (8184704)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q4S-JQ64J+M2TV (8167080)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q6S-3KL+M3TV (8170921)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q6S-4J+M2TT (8167081)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q6S-4JE+M3TV (8167082)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q6S-5A+M2TT (8167083)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q6S-5J+M3TV (8167084)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q6S-6J+M2TT (8184705)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q6S-6J+M2TV (8167085)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-UR-Q6S-E4J+M3TV (8170922)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10RA-U-T18S-12G (8184706)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10R-UR-Q4S-10G+M2TT (8184707)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10R-UR-Q4S-8J+M2TT (8167086)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q4S-JJTSGG+M2TT (8170923)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q4S-JJTSGG+M2TT (8170924)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q4S-JJTSGG+M3TT (8184708)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q6S-4J+M2 (8167087)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q6S-4J+M2 (8167088)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q6S-5G+M3TT (8184709)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q6S-5J+M2 (8167109)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q6S-6J+M2 (8167110)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q6S-6JTSKK+M2 (8167111)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-Q6S-8J+M2TT (8167112)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q10-U-QH6S-3GJJPPL (8167953)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q6LA-UL-Q4S-4A4K4L+MA1 (8199369)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8A-UC-Q6S-JXCCJXCCTSHJQ4JQ4JQ4LCCLCC (8191545)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8A-U-Q4S-5KJ3KNNL (8166187)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8B-UB-QH4SU-L3K (8166328)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8B-UB-QH6SU-4VKZSXZS3A3L+M1TTSC (8223797)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8LA-UCL-Q6S-3AQ4AQ4+MA1 (8214665)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8LA-UL-Q4S-5J+M2TT (8167113)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8LA-UL-Q4S-JQ64JK+M3TT (8167114)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8LA-UL-Q6S-7J+M2 (8170925)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8LA-U-Q4S-JQ6JQ64J (8184710)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8LA-UR-Q4S-10VK (8203569)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8L-UL-Q4S-4J+M2TT (8170926)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8L-UL-Q4S-4J+M2TV (8170927)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8L-UL-Q6S-10J+M2 (8170928)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8L-UL-Q6S-3KJJAA3J (8240234)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8L-UL-Q6S-4J+M2TT (8170929)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8L-UL-Q6S-4J+M2TT (8170930)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8L-UL-Q6S-E5JEJBBAL (8240235)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8R-UR-Q4S-5J+M2TT (8170931)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8-U-Q6S-JJTSGG+M3TV (8170932)
  • Valve terminal VTUG-10-MSDR-B1T-25V20-Q8-UR-Q6S-5G (8170933)
  • Valve terminal VTUG-10-MSDR-B1T-25V22-Q10-U-Q6S-8J+M2TT (8170934)
  • Valve terminal VTUG-10-MSDR-B1T-44V21-Q10LA-UL-Q4S-17J3L+M3TT (8184711)
  • Valve terminal VTUG-10-MSDR-B1T-44V21-Q10LA-UL-Q4S-18JPP+M3TT (8231020)
  • Valve terminal VTUG-10-MSDR-B1T-44V21-Q10-U-Q6S-4J8VK+HM2TT (8196796)
  • Valve terminal VTUG-10-MSDR-B1T-44V21-T516-U-TH316S-4A (8236039)
  • Valve terminal VTUG-10-MSDR-B1TZ-25V20-Q10-U-Q4S-JJTSGG+M2TT (8167115)
  • Valve terminal VTUG-10-MSDR-B1TZ-25V20-Q8-U-Q4S-PPTPSDPPTPPP+H (8191587)
  • Valve terminal VTUG-10-MSDR-B1TZ-25V20-Q8-U-Q4S-PPTPSDPPTPSDPPTP4VK+H (8191588)
  • Valve terminal VTUG-10-MSDR-B1TZ-25V20-Q8-U-Q4S-PPTPSDPPTPSDPPTPVKVK+H (8191589)
  • Valve terminal VTUG-10-MSDR-S1T-25V20-G18-U-M7S-4G (8165269)
  • Valve terminal VTUG-10-MSDR-S1T-25V20-Q6L-UL-Q4S-4K (8199712)
  • Valve terminal VTUG-10-MSDR-S1T-25V20-Q6L-UL-Q4S-6K (8199713)
  • Valve terminal VTUG-10-MSDR-S1T-25V20-Q8A-U-Q6S-3JTSJ+M2TV (8167116)
  • Valve terminal VTUG-10-MSDR-S1T-25V20-Q8LA-UR-QH6S-ALNN (8193100)
  • Valve terminal VTUG-10-MSDR-S1T-25V20-Q8LA-UR-QH6S-ANAN (8193099)
  • Valve terminal VTUG-10-MSDR-S1TZ-25V20- :SM (8196006)
  • Valve terminal VTUG-10-MSDR-S8-B1T-25V20-G18-DQ-Q4S-8VN (8187736)
  • Valve terminal VTUG-10-MSDR-S8-B1T-25V20-G18L-DT-QH4S-KQH63P+TT* (8023777)
  • Valve terminal VTUG-10-MSDR-S8-B1T-25V20-Q6A-DT-QH6SU-5GTSPQM7+* (8024255)
  • Valve terminal VTUG-10-SH2S1TQ6LULQH4S-VML+W2:SM (8108538)
  • Valve terminal VTUG-10-SH2S1TQ6LULQH4S-VMVM+W2:SM (8108539)
  • Valve terminal VTUG-10-SR8-B1T-Q8R-DTR-QH4S-AA:SM (8127813)
  • Valve terminal VTUG-10-VRAP-B1HZ-Q10L-UL-Q6S-4VK4J+H (8178960)
  • Valve terminal VTUG-10-VRAP-B1T-G18-U-Q6S-5P4KL (8156920)
  • Valve terminal VTUG-10-VRAP-B1T-Q10LA-UL-Q6S-8G (8140154)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-10A (8156898)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-10J (8150988)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-14JLL (8150963)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-20J (8150966)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-4A (8156901)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-4AJJ (8156934)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-6A (8156900)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-6JLL (8150989)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-UL-Q6S-8A (8156899)
  • Valve terminal VTUG-10-VRAP-B1T-Q10L-U-Q6S-24P (8193413)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-10VK6L (8145687)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-10VKQ6VKQ6VKQ6VKQ6VKQ6VKQ6L (8143549)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-11VKL (8143550)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-13J3L (8141452)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-15VK5L (8145686)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-15VKL (8143551)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-15VKQ6VKQ6VKQ63L (8143548)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-16J4L (8141451)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-16VKQ6VKQ63L (8143547)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-16VKQ6VKQ6VKQ6VKQ6VKQ64L (8143546)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q4S-24VK (8145685)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q6S-12J (8156897)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q6S-16J (8156896)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q6S-19J5L (8193149)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q6S-20G (8156895)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q6S-24G (8156894)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q6S-4G20J (8206214)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q6S-4L3PL4J3PL4JLLJJ (8242964)
  • Valve terminal VTUG-10-VRAP-B1T-Q10-U-Q6S-JJB16J5L (8206215)
  • Valve terminal VTUG-10-VRAP-B1T-Q8A-U-Q6S-GGTSGQ4GQ4JQ4JQ4 (8140155)
  • Valve terminal VTUG-10-VRAP-B1T-Q8L-UR-M5S-L4PL (8156921)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-10J (8242965)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-10J6L (8187807)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-3G15JLL (8187810)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-3JLL3JLL (8206217)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-3P6JLL8JPJJLL (8206218)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-4J (8187809)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-4L8J3LJ (8242966)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-4L8J4L (8206219)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-8JLL (8187808)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-JE3JEJJ4L (8206220)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-JE3JEJJLLJJ (8193146)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-JE4JLLJE4JLL (8206230)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-JJB16JL (8206216)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-JJB6JLL8JL (8242967)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-JJG6JGG8JL (8192522)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-LLP4JP5JLLJJ3LTPJJLL (8206221)
  • Valve terminal VTUG-10-VRAP-B1T-Q8-U-Q6S-LLP6JLTPLJJLL4JLJJLL (8193148)
  • Valve terminal VTUG-10-VRAP-B1TZ-G18L-UL-Q6S-4VKLL (8150967)
  • Valve terminal VTUG-10-VRAP-B1TZ-Q10-DT-Q6S-GXCCGXCCGXCCGXCCGXCCGXCCGXCCGXCCGXCCGXCCLCCLCCLCCLCCGCCXQ6GCCXQ6GCCXQ6GCCXQ6GCCXQ6GCCXQ6GCCXQ6GCCXQ6GCCXQ6GCCXQ6 (8141456)
  • Valve terminal VTUG-10-VRAP-B1TZ-Q10L-UL-Q6S-3VKL (8150968)
  • Valve terminal VTUG-10-VRAP-B1TZ-Q10L-UL-Q6S-VKVKLL (8150969)
  • Valve terminal VTUG-10-VRAP-B1TZ-Q10-U-Q4S-LCC6VKLCC (8141454)
  • Valve terminal VTUG-10-VRAP-S1T-G18L-U-Q6S-7P (8156922)
  • Valve terminal VTUG-10-VRAP-S1T-G18L-UR-M5S-P6KL (8156923)
  • Valve terminal VTUG-10-VRAP-S1T-Q10LA-UL-Q6S-10G (8140156)
  • Valve terminal VTUG-10-VRAP-S1T-Q10LA-UL-Q6S-8G (8140157)
  • Valve terminal VTUG-10-VRAP-S1TZ-Q10A-DT-Q4S-GXCCGXCCGXCCGXCC4LTSGQ6GQ6 (8150770)
  • Valve terminal VTUG-10-VRAP-S1TZ-Q10A-DT-Q4S-GXCCGXCCGXCCGXCC4LTSLGQ6 (8150769)
  • Valve terminal VTUG-10-VRAP-S8-B1T-Q10-U-QH4S-VH6VK10AQH63AQH6XQH4 (8219956)
  • Valve terminal VTUG-10-VRAP-S8-B1T-Q10-U-QH4S-VNQH6VNQH6VN7VKQH6XQH4AQH613AQH6 (8219955)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-10J (8163419)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-10JLL (8163416)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-11JL (8240236)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-13J3L (8163434)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-14JLL (8163414)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-18JLL (8163437)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-20J (8174590)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-22JLL (8188499)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-3J3L (8208914)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-4J (8163439)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-4JLL (8163422)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-4VK (8166427)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-5JL (8163413)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-6J (8188495)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-6JLL (8163394)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-8J (8163415)
  • Valve terminal VTUG-10-VRLK-B1T-Q10L-UL-Q6S-9JL (8208912)
  • Valve terminal VTUG-10-VRLK-B1T-Q10R-UC-Q4S-7KSJQ6AJQ6JQ6ACCXQ6LCCLCCLCC (8191544)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-10PEE+TT (8183146)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-3PE3PQ6JQ6JQ6L+TT (8183147)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-4PE4PQ6PQ6JQ6JQ6+TT (8170021)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-4PGQ6PQ63PQ6PQ6PPQ6PQ6PPL+TT (8183148)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-4PQ6PQ6PQ6PQ6PPQ63P+TT (8170022)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-6PE6PELL+TT (8170032)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-6PE6PEPPQ6+TT (8183149)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-8PQ6PQ6PJJQ6PQ63L+TT (8183150)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q4S-PQ6PQ6PPQ64PQ6PQ6PQ6PQ69P+TT (8183151)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q6S-4JPQ4PQ4PQ4PQ4PQ4PQ4J8PL+TT (8183152)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q6S-4PQ4PQ4PQ46P+TT (8170033)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q6S-4PQ4PQ4PQ4PQ4PQ47PL+TT (8170034)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q6S-JJPJJPPQ44PQ43PQ4LL+TT (8183153)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q6S-PPQ4PQ4GGPQ4PQ4PQ4LL+TT (8183154)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q6S-PQ4PQ43PQ4PQ4PQ43PEPQ4PQ4PPEJJLL+TT (8183155)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-UC-Q6S-PQ4PQ4PQ4PQ4PQ43PQ4PQ4PQ4JJPJJP+TT (8183156)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-U-M7S-18JLL (8213719)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-U-Q4S-12VK (8166429)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-U-Q4S-15VK5L (8166428)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-U-Q4S-24VK (8163432)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-U-Q4S-8PQ6PQ6PJJQ6PQ63L+TT (8170035)
  • Valve terminal VTUG-10-VRLK-B1T-Q10-U-Q6S-24J (8174591)
  • Valve terminal VTUG-10-VRLK-B1T-Q6-U-Q4S-KCCXQ44KLL (8240245)
  • Valve terminal VTUG-10-VRLK-B1T-Q8A-U-QH6S-AQH4XR1VNVNLGGTS4GLL (8192693)
  • Valve terminal VTUG-10-VRLK-B1T-Q8L-DT-QH4S-14JLL (8170294)
  • Valve terminal VTUG-10-VRLK-B1T-Q8L-DT-QH4S-6JE6JEJJ (8170267)
  • Valve terminal VTUG-10-VRLK-B1T-Q8L-UL-Q4S-20G (8197787)
  • Valve terminal VTUG-10-VRLK-B1T-Q8-U-Q4S-11PG4P+TT (8214240)
  • Valve terminal VTUG-10-VRLK-B1T-Q8-U-QH4SU-13N3L (8208323)
  • Valve terminal VTUG-10-VRLK-B1T-Q8-U-QH4SU-18NLL (8208324)
  • Valve terminal VTUG-10-VRLK-B1T-Q8-U-QH4SU-24N (8208325)
  • Valve terminal VTUG-10-VRLK-B1T-T38A-U-TH14SU-14PLL (8176700)
  • Valve terminal VTUG-10-VRLK-B1T-T38LA-U-TH14SU-9PL (8172068)
  • Valve terminal VTUG-10-VRLK-B1T-T516A-UR-TH14S-16P (8177293)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q10L-UL-Q6S-3VKL (8166430)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q10L-UL-Q6S-4VK (8163433)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q10L-UL-Q6S-5VK (8188500)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q10-U-Q6S-6VK (8240247)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q8-DT-Q6S-3NTSNLCCLCCLCCLCC+H (8186235)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q8-DT-Q6S-8A+H (8186234)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q8L-DT-Q4S-4G4J (8170242)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q8L-DT-Q4S-4G5JL (8170243)
  • Valve terminal VTUG-10-VRLK-B1TZ-Q8L-DT-Q4S-4G9J3L (8170244)
  • Valve terminal VTUG-10-VRLK-B1Y-G18-UR-Q6S-3GEEKTPGQ4XCCZS (8206071)
  • Valve terminal VTUG-10-VRLKL-B1T-Q10L-UL-QH6S-12A (8158432)
  • Valve terminal VTUG-10-VRLK-S1T-Q10L-UL-Q6S-6JLLGG+TT (8197786)
  • Valve terminal VTUG-10-VRLK-S8-B1H-T38A-U-T14S-5P5L (8186503)
  • Valve terminal VTUG-10-VRLK-S8-B1T-G18-DT-QH6S-&+* (5345147)
  • Valve terminal VTUG-10-VRLK-S8-B1T-G18-DT-QH6S-4JLL6J+* (8069711)
  • Valve terminal VTUG-10-VRLK-S8-B1T-G18-DT-QH6S-AXR1L4JLL4JLLJJ+* (5341032)
  • Valve terminal VTUG-10-VRLK-S8-B1T-G18-DT-QH6S-AXR1L4JLL8J+* (8076522)
  • Valve terminal VTUG-10-VRLK-S8-B1T-Q10LA-U-QH4SU-12P (8224800)
  • Valve terminal VTUG-10-VRLK-S8-B1T-Q8A-U-QH4SU-12P (8172069)
  • Valve terminal VTUG-10-VRLK-S8-B1T-Q8A-U-QH6SU-12P (8168069)
  • Valve terminal VTUG-10-VRLK-S8-B1T-Q8-DTL-Q4S-GG8J (8170233)
  • Valve terminal VTUG-10-VRLK-S8-B1T-Q8LA-DT-QH4S-5VKQM74JGQH6LQH6LQH6XXAQH6XR1LQH6LQH6LQH6+* (8028487)
  • Valve terminal VTUG-10-VRLK-S8-B1T-Q8LA-UL-QH4S-13VK4J3L+TT (8185844)
  • Valve terminal VTUG-10-VRLK-S8-B1T-Q8LA-UL-QH4S-8VK4J4L+TT (8185843)
  • Valve terminal VTUG-10-VRLK-S8-B1T-Q8LA-UL-QH6S-3AQH4AQH43AQH4AQH4AA3LQH4LQH4LL+TT (8185842)
  • Valve terminal VTUG-10-VRLK-S8-B1T-T38A-U-TH14SU-10P (8177294)
  • Valve terminal VTUG-10-VRLK-S8-B1T-T38LA-U-QH4SU-12P (8215483)
  • Valve terminal VTUG-10-VRLK-S8-B1T-T38LA-U-TH14SU-12P (8226763)
  • Valve terminal VTUG-10-VRLK-S8-B1T-T38LA-U-TH14SU-8P (8237026)
  • Valve terminal VTUG-10-VRLK-S8-B1TZ-Q8-DT-Q4S-6J5E5K4L (8170295)
  • Valve terminal VTUG-10-VRLK-S8-B1TZ-Q8-DT-Q4S-9JKLL (8170269)
  • Valve terminal VTUG-10-VRLK-S8-B1TZ-Q8-DT-Q4S-E18JK (8170296)
  • Valve terminal VTUG-10-VRLK-S8-B1TZ-Q8-DT-Q4S-EE4JLL (8170297)
  • Valve terminal VTUG-10-VRLK-S8-B1TZ-Q8-DT-Q4S-J9KLL (8170270)
  • Valve terminal VTUG-10-VRLK-S8-B1TZ-Q8-DT-Q4S-JJ17KL (8170237)
  • Valve terminal VTUG-10-VRLK-S8-B1TZ-Q8-DT-QH4S-20K (8170238)
  • Valve terminal VTUG-10-VRPT-B1H-Q8-U-Q6S-5VK3JVKVKSVK3J5VK+TT (8207253)
  • Valve terminal VTUG-10-VRPT-B1T-L-Q8A-U-M5S-12VK (8182010)
  • Valve terminal VTUG-10-VRPT-B1T-L-Q8A-U-M5S-8VK4G (8182012)
  • Valve terminal VTUG-10-VRPT-B1T-L-Q8A-U-M5S-G8VKGLL (8182166)
  • Valve terminal VTUG-10-VRPT-B1T-L-Q8RA-UR-M5S-4G4VK (8183297)
  • Valve terminal VTUG-10-VRPT-B1T-L-Q8RA-UR-M5S-6GVKVK (8183298)
  • Valve terminal VTUG-10-VRPT-B1T-L-Q8RA-UR-M5S-6VKGG (8182011)
  • Valve terminal VTUG-10-VRPT-B1T-L-Q8RA-UR-M5S-8G (8182009)
  • Valve terminal VTUG-10-VRPT-B1T-L-Q8RA-UR-M5S-8VK (8182008)
  • Valve terminal VTUG-10-VRPT-B1T-Q10A-U-Q4S-15KJQ6JQ6JQ6JQ6JQ6 (8174439)
  • Valve terminal VTUG-10-VRPT-B1T-Q10A-U-Q4S-16K (8174440)
  • Valve terminal VTUG-10-VRPT-B1T-Q10B-UB-QH6SUZS-12K+TV (8194148)
  • Valve terminal VTUG-10-VRPT-B1T-Q10B-UB-QH6SUZS-16K+TV (8194159)
  • Valve terminal VTUG-10-VRPT-B1T-Q10B-UB-QH6SUZS-24K+TV (8194147)
  • Valve terminal VTUG-10-VRPT-B1T-Q10B-UB-QH6SUZS-8K+TV (8194152)
  • Valve terminal VTUG-10-VRPT-B1T-Q10LA-UL-Q4S-4K (8174442)
  • Valve terminal VTUG-10-VRPT-B1T-Q10LA-UL-Q4S-7K (8174441)
  • Valve terminal VTUG-10-VRPT-B1T-Q10L-UL-Q6S-10A (8156890)
  • Valve terminal VTUG-10-VRPT-B1T-Q10L-UL-Q6S-4A (8156893)
  • Valve terminal VTUG-10-VRPT-B1T-Q10L-UL-Q6S-6A (8156892)
  • Valve terminal VTUG-10-VRPT-B1T-Q10L-UL-Q6S-8A (8156891)
  • Valve terminal VTUG-10-VRPT-B1T-Q10-UC-Q6S-JJPJJPPQ44PQ4PQ43PL+TT (8170036)
  • Valve terminal VTUG-10-VRPT-B1T-Q10-U-Q6S-12J (8156889)
  • Valve terminal VTUG-10-VRPT-B1T-Q10-U-Q6S-16J (8156888)
  • Valve terminal VTUG-10-VRPT-B1T-Q10-U-Q6S-20G (8156887)
  • Valve terminal VTUG-10-VRPT-B1T-Q10-U-Q6S-24G (8156886)
  • Valve terminal VTUG-10-VRPT-B1T-Q10-U-Q6S-24VK+HTT (8194218)
  • Valve terminal VTUG-10-VRPT-B1T-Q10-U-QH6S-KK5ALALK3LAL (8136442)
  • Valve terminal VTUG-10-VRPT-B1T-Q6A-UC-Q4S-16K (8234701)
  • Valve terminal VTUG-10-VRPT-B1T-Q6LA-UCL-Q4S-12K (8234705)
  • Valve terminal VTUG-10-VRPT-B1T-Q6RA-UCR-Q4S-4K (8234700)
  • Valve terminal VTUG-10-VRPT-B1T-Q6RA-UCR-Q4S-7K5J (8234704)
  • Valve terminal VTUG-10-VRPT-B1T-Q6-U-Q6S-7K (8219492)
  • Valve terminal VTUG-10-VRPT-B1T-Q6-U-Q6S-8K (8219494)
  • Valve terminal VTUG-10-VRPT-B1T-Q8A-UC-M5S-10K7A3L (8184359)
  • Valve terminal VTUG-10-VRPT-B1T-Q8A-UC-M5S-21A3L (8214664)
  • Valve terminal VTUG-10-VRPT-B1T-Q8A-UC-M5S-23AL (8184357)
  • Valve terminal VTUG-10-VRPT-B1T-Q8A-UC-M5S-4A4LTS7AL (8214662)
  • Valve terminal VTUG-10-VRPT-B1T-Q8A-UC-M5S-8ATS7AL (8184360)
  • Valve terminal VTUG-10-VRPT-B1T-Q8A-UC-M5S-KK6ALL (8184356)
  • Valve terminal VTUG-10-VRPT-B1T-Q8A-UC-M5S-KK8A (8214663)
  • Valve terminal VTUG-10-VRPT-B1T-Q8B-UB-QH4SU-14KEE (8166327)
  • Valve terminal VTUG-10-VRPT-B1T-Q8B-UB-QH4SU-16E (8166329)
  • Valve terminal VTUG-10-VRPT-B1T-Q8LA-DTL-Q4S-6G3J3K (8174100)
  • Valve terminal VTUG-10-VRPT-B1T-Q8L-DTL-QH4S-3ALCCLCC:SM (8127812)
  • Valve terminal VTUG-10-VRPT-B1T-Q8L-UCL-Q4S-12VK (8234698)
  • Valve terminal VTUG-10-VRPT-B1T-Q8L-UL-Q6S-15A5L (8189270)
  • Valve terminal VTUG-10-VRPT-B1T-Q8L-UR-M5S-G5P (8156924)
  • Valve terminal VTUG-10-VRPT-B1T-Q8L-UR-Q4S-14JEJ (8174660)
  • Valve terminal VTUG-10-VRPT-B1T-Q8RA-DTR-Q4S-6G3J3K (8174099)
  • Valve terminal VTUG-10-VRPT-B1T-Q8R-DTR-QH4S-5A:SM (8127811)
  • Valve terminal VTUG-10-VRPT-B1T-Q8R-UCR-Q4S-JJ3VK (8234699)
  • Valve terminal VTUG-10-VRPT-B1T-Q8-U-Q4S-16VK+HTT (8234706)
  • Valve terminal VTUG-10-VRPT-B1T-Q8-U-Q4S-4JTS4J (8174698)
  • Valve terminal VTUG-10-VRPT-B1TZ-Q10-DTL-Q4S-EZSXZSEZSXZSEZSXZSEQ6ZSXZSEZSXZSEZSXZSEZSXZSEZSXZSEQ6ZSXZSEQ6ZSXZSEQ6ZSXZSEZSXZSEZSXZSEZSXZSEZSXZS5L+TT (8230324)
  • Valve terminal VTUG-10-VRPT-B1TZ-Q10-DTL-Q4S-EZSXZSEZSXZSEZSXZSEQ6ZSXZSEZSXZSEZSXZSEZSXZSEZSXZSEZSXZSEZSXZSEZSXZSEZSXZSEZSXZSEZSXZSLZSXZSLZSXZS+TT (8230337)
  • Valve terminal VTUG-10-VRPT-B1TZ-Q10-DTL-Q6S-EZSXZSEZSXZSEZSXZSEQ4ZSXZSEQ4ZSXZSEZSXZSEZSXZSEZSXZSEQ4ZSXZSEQ4ZSXZSEQ4ZSXZSEZSXZSEQ4ZSXZSEQ4ZSXZSLZSXZSLZSXZS+TT (8230338)
  • Valve terminal VTUG-10-VRPT-B1TZ-Q10-DTL-Q6S-EZSXZSEZSXZSEZSXZSEQ4ZSXZSEQ4ZSXZSEZSXZSEZSXZSEZSXZSEQ4ZSXZSEQ4ZSXZSEQ4ZSXZSEZSXZSEZSXZSEQ4ZSXZSEQ4ZSXZS5L+TT (8230339)
  • Valve terminal VTUG-10-VRPT-S1T-G18-U-Q6S-GGPGGPGGPGG6P3L (8156925)
  • Valve terminal VTUG-10-VRPT-S1T-T38A-U-T18S-16K (8203340)
  • Valve terminal VTUG-10-VRPT-S1T-T38A-U-T18S-20K (8203341)
  • Valve terminal VTUG-10-VRPT-S1T-T38LA-UL-T18S-7K (8203342)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-UFD-QH6SFD-12K+SCEX2E (8168266)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-UFD-QH6SFD-13K3L+SCEX2E (8170044)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-UFD-QH6SFD-16K+SCEX2E (8170045)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-UFD-QH6SFD-20K4L+SCEX2E (8170046)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-UFD-QH6SFD-22KLL+SCEX2E (8170047)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-UFD-QH6SFD-24K+SCEX2E (8170048)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-UFD-QH6SFD-6KLL+SCEX2E (8170050)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-UFD-QH6SFD-8K+SCEX2E (8169874)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-10KGG8K+HTT (8208365)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-11KG+HTT (8208361)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-4G8K+HTT (8208363)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-4K3G5K+HTT (8208364)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-4K8G+HTT (8210408)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-6K6G+HTT (8210407)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-6KG4H6KGGKG3K+HTT (8203634)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-6KG4H7K5GK+HTT (8208366)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-6KTP5K5G4H+HTT (8208368)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-7KG+HTT (8208367)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-8K3GK+HTT (8203633)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH4S-8KTP3G9K3GK+HTT (8202635)
  • Valve terminal VTUG-10-VRPT-S8-B1T-Q8A-U-QH6S-6G6K+HTT (8208362)
  • Valve terminal VTUG-10-VRPT-S8-S1T-Q8-U-Q6S-5VK+TT (8217234)
  • Valve terminal VTUG-10-VRPT-S8-S1T-Q8-U-Q6S-5VK+TT (8217263)
  • Valve terminal VTUG-10-VRPT-S8-S1T-Q8-U-Q6S-6VK+TT (8217254)
  • Valve terminal VTUG-10-VRPT-S8-S1T-Q8-U-Q6S-8VK+TT (8217252)
  • Valve terminal VTUG-10-VRPT-S8-S1Y-Q10LA-UR-QH6S-6P (8186233)
  • Valve terminal VTUG-10-VRPT-S8-S1Y-Q10LA-UR-QH6S-6P:SM (8160082)
  • Valve terminal VTUG-14- -6ATS4AGQ8GQ8:SM (8161644)
  • Valve terminal VTUG-14- -AVKQ8JLQG18:SM (8161962)
  • Valve terminal VTUG-14- AXR1AXR1AXR1J:SM (8162030)
  • Valve terminal VTUG-14- -JQ6VKATPAQG18:SM (8161974)
  • Valve terminal VTUG-14- PAXR1AXR1+:SM (8163205)
  • Valve terminal VTUG-14- -VKVKJJGAA9L+TT:SM (8161636)
  • Valve terminal VTUG-14 „MP...MVKMTPSVKTSJJLM3L“ (8041548)
  • Valve terminal VTUG14 2-242-95-6570 (8069549)
  • Valve terminal VTUG14 2-242-95-6580 (8069547)
  • Valve terminal VTUG14 2-242-95-7031 (8069544)
  • Valve terminal VTUG14 2-242-95-7040 (8069550)
  • Valve terminal VTUG14 2-242-95-7050 (8069551)
  • Valve terminal VTUG14 2-242-95-7080 (8069552)
  • Valve terminal VTUG14 2-242-95-7090 (8069553)
  • Valve terminal VTUG14 M8 2-242-95-6680 (8069548)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-10J3LTP3VK (8188823)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-11J3VKTPVKVK (8189048)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-11JVK (8188819)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-12JVKVKTPVKVK (8189049)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-13JLVKVK (8188817)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-13JTP3VK (8189050)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-14JTPVKVK (8188824)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-16A (8189064)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-16G (8189051)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-16J (8188816)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-16K (8189065)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-3GAJJ3LTP3VK (8189052)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-4AGG4A (8189054)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-4G4JLLTPVKVK (8189053)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-4GAA5JVK (8188818)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-4JEE8JGG (8189055)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-6JLL (8189056)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-8JLLTPVKVK (8188821)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-8JVKTP3VK (8189057)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-9J4LVKTPVKVK (8188820)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-9JTPSAAVKVKTPVKVK (8189058)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-E8KL (8189059)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-G10JA (8189060)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-GG18J (8188815)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-GGA8JLLTP3VK (8189061)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-L12JTP3VK (8188825)
  • Valve terminal VTUG-14-GR-B1T-G14-DT-G18S-VK12JTP3VK (8188826)
  • Valve terminal VTUG-14-GR-B1TZ-G14-DT-G18S-13JGJJ (8188827)
  • Valve terminal VTUG-14-GR-B1TZ-G14-DT-G18S-16J (8189062)
  • Valve terminal VTUG-14-GR-B1TZ-G14-DT-G18S-5JEE9J (8188828)
  • Valve terminal VTUG-14-GR-B1TZ-G14-DT-G18S-JJGJJG4JGJJGJJ (8189063)
  • Valve terminal VTUG-14-MRCR-B1T-50V26-Q12A-U-Q6S-22JLL+TT (8167117)
  • Valve terminal VTUG-14-MRCR-B1T-50V26-Q12LA-UL-Q8S-24G+TT (8167118)
  • Valve terminal VTUG-14-MSDR-... 5042728 (8036784)
  • Valve terminal VTUG-14-MSDR-B1H-25V20-Q8FDL-UFDL-Q8SFD-4M+M1SCEX2E (8206495)
  • Valve terminal VTUG-14-MSDR-B1T-25V20 -G14-U-Q8S-6JL (8184950)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-G14-DT-G18SU-5J5M (8159006)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-G14-DT-G18SU-6G (8159005)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-G14-DT-G18SU-7M5L (8159004)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-G14-DT-G18SU-8G (8159003)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-G14-DT-G18SU-MMTPMM (8159002)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-G14-UFD-Q8SFDSH-12M+M2TTSC (8199386)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-G14-UFD-Q8SFDSH-24M+M2TTSC (8199385)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10A-UR-Q6S-4G3A3L (8230403)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10A-UR-Q6S-JJ7A3L (8230404)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10-DT-Q8S-KQ4KQ4TR4AQ64AQ6LQ4LCC (8191543)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-G18S-3M3GLL+M3 (8169360)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-G18S-4G4J+M3 (8169363)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q6S-3JQ4JQ4+M2TT (8167119)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q6S-4G+M1TT (8184716)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q6S-4G+M3TT (8184717)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q6S-6G+M3TT (8167120)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q6S-6J+M2TT (8167121)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q6S-6J+M3TT (8184718)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q6S-JQ85JQ8+M2TT (8167122)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q6SU-4M+M2TT (8170935)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q8S-8GLL+M3 (8169255)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UL-Q8S-GG4J+M3TT (8170936)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-U-Q8S-3JQ6JQ6+M1TT (8167123)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-U-Q8S-7J+M2 (8184719)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-U-Q8S-8J+M2 (8184720)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10LA-UR-Q6S-6G+M3TT (8231022)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-DQL-Q8S-4G+M2 (8170937)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q4S-5J+M2TT (8170938)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q4S-6J+M2 (8167124)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-10ELL (8176271)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-4ELL (8176270)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-4J+M2TT (8167125)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-4JQ4JQ4JQ4K+M2TT (8167126)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-5J+M3TT (8184712)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-6ELL (8176273)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-6J+M2TT (8170939)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-6J+M3TT (8170940)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q6S-8ELL (8176272)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q8S-10G+M3TT (8170941)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q8S-4J+M1TT (8167127)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q8S-4J+M2TT (8170942)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q8S-4J+M3TT (8170943)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UL-Q8S-6J+M2TT (8170944)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-U-Q8S-G3J+M2TT (8184721)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-U-Q8S-KKTR4JE+M3TT (8167128)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10L-UR-Q6S-3J3H+M3TT (8167129)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-G18S-10G+M3 (8169362)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-G18S-4J6GLL+M3 (8169358)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-G18S-4JGG+M3 (8169359)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-G18S-6G4L+M3 (8169361)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-Q4S-6J+M2TT (8170945)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-Q6S-3JL+M3 (8167130)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-Q6S-3JL+M3TT (8184722)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-Q6S-4J+M2TT (8170946)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-Q6S-MMJQ8JQ8+M2TT (8170947)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-Q8S-4J+M2TT (8170948)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UL-Q8S-6J+M3 (8170949)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q4S-10G+M3TT (8184723)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q6S-12J+M1TT (8184724)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q6S-4J+M1TT (8170950)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q6S-4J+M2TT (8170951)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q6S-4JQ8+M2TT (8170956)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q6S-5JQ4JQ4+M2TT (8170957)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q6S-6J+M2TT (8184725)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q6S-6J+M3TT (8184726)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10RA-UR-Q8S-JJ6K+M1TT (8170958)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UL-Q6S-3J4K+M3TT (8167131)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UL-Q6S-4J+M2TT (8170959)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q4S-10J+M3TT (8167132)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q4S-10JQ6+M3TT (8167133)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q4S-6J+M3TT (8167134)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q4S-8J+M2TT (8167157)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q4S-9J+M2TT (8170960)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q4S-9J+M2TT (8170961)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-10G+M3TT (8170962)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-4J (8170963)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-4J+M2TT (8167158)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-5J+M2TT (8170964)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-5J+M3TT (8184713)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-6J+M2TT (8184714)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-6J+M3TT (8184727)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-6K+M1TT (8167159)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-6K+M3TT (8184728)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-7J+M2TT (8184715)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q6S-9JQ8JQ8JQ8JQ8+M2TT (8167160)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q8S-10G+M3TT (8170965)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q8S-3J3K+M3TT (8170966)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q8S-4J+M2TT (8170967)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q8S-5G+M3TT (8170968)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q8S-5JL+M2TT (8170969)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10R-UR-Q8S-8J+M3TT (8167161)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10-UL-Q6S-4G+M2TT (8184729)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10-U-Q4S-5J+M2TT (8170970)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10-U-Q6S-4J+M2TT (8170971)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10-U-Q6S-4J+M2TV (8170972)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10-U-Q6S-8J+M2TV (8170973)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10-U-Q6S-JKTPMM3L+M2 (8203230)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q10-U-Q8S-JJTSGG (8167162)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12A-U-Q8S-3KTSKK3LMM (8224667)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UL-Q6S-10J+M3TT (8167163)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UL-Q6S-9J+M2 (8184730)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UL-Q8S-3JQ6JQ6JQ6JQ6+M2TT (8184731)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UL-Q8S-5J+M1TV (8167164)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-U-Q6S-8G+M3TT (8167165)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UR-Q6S-4J4K+M2TT (8167167)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UR-Q6S-4J4K+M3TT (8184732)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UR-Q8S-3J3K+M2TT (8170974)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UR-Q8S-4KJJ+M2TT (8167168)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12LA-UR-Q8S-6K+M2TT (8170975)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12L-UL-Q6S-10G+M3TT (8170976)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12L-UL-Q6S-10J+M3TT (8167169)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12L-UL-Q6S-6J+M2TT (8170977)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12L-UL-Q6S-KK3J+M3TT (8184733)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12L-U-Q8S-10G+M3TT (8184734)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12L-UR-Q6S-12J+M1 (8170978)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12RA-UR-Q6S-10G+M3TT (8167170)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12R-U-Q6S-7J+M2TT (8170979)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12R-UR-Q6S-5JKK+M3TT (8184735)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12-U-Q4S-MM8J+M2TT (8170980)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12-U-Q4SU-MM8J+M2TT (8170981)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12-U-Q6S-5JMM+M2TT (8170982)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q12-U-Q8S-3BQ6BQ6BQ6BQ6BQ4BQ4BQ4BQ4BQ4BQ4+M2TT (8171062)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8-DTFD-Q8SFDSH-16A+AM1TT (8201612)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8-DTFD-Q8SFDSH-8A+AM1TT (8201616)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8LA-UL-Q4S-7J+M2 (8184736)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8LA-UL-Q6S-8G+M3TT (8167171)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8LA-UL-Q8S-3JQ6JQ6JQ6+M2 (8184737)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8LA-UR-Q6S-6J+M2TT (8170983)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8LA-UR-Q6SU-3JQ4NQ4JJ+M2TT (8170984)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8L-UL-Q4S-10JQ6+M3TT (8167172)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8L-UL-Q6S-4J+M2TT (8170985)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8L-UL-Q6S-8J+M3TT (8167173)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8L-U-Q4S-M4JMM3JMM+M2 (8170986)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8L-U-Q4S-M6JM+M2 (8170987)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8L-UR-Q6S-4JL+M2 (8170988)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8R-UR-Q6S-GGLL+M2TT (8170989)
  • Valve terminal VTUG-14-MSDR-B1T-25V20-Q8-UR-Q6S-4G+M2TT (8170990)
  • Valve terminal VTUG-14-MSDR-B1T-25V23-Q10LA-UL-Q8S-6J+M3TT (8170991)
  • Valve terminal VTUG-14-MSDR-B1T-25V23-Q12LA-UL-Q8S-JJGG+M2TT (8231023)
  • Valve terminal VTUG-14-MSDR-B1T-44V21-Q12A-U-Q6S-5JQ8JQ8JQ8JQ84J+M3TT (8167174)
  • Valve terminal VTUG-14-MSDR-B1T-44V21-Q12LA-UL-Q4S-16J+M2TV (8231024)
  • Valve terminal VTUG-14-MSDR-B1T-44V21-Q12LA-UL-Q4S-16J+M3TV (8231025)
  • Valve terminal VTUG-14-MSDR-B1T-44V21-Q12LA-UL-Q8S-9GQ6GQ6GQ6GQ6GQ6GQ6GQ6GQ6+M3TT (8231026)
  • Valve terminal VTUG-14-MSDR-B1T-44V21-Q12L-UL-Q6S-9KJQ8JQ85J+M3TT (8170992)
  • Valve terminal VTUG-14-MSDR-B1T-44V21-Q12L-UL-Q6S-9KJQ8JQ85J+M3TT (8170993)
  • Valve terminal VTUG-14-MSDR-B1T-44V21-Q12L-UR-Q6S-18GAM+M2TT (8170994)
  • Valve terminal VTUG-14-MSDR-B1TZ-25V20-Q8R-DQR-Q6S-6G+M2TT (8170995)
  • Valve terminal VTUG-14-MSDR-B1TZ-25V20-Q8-U-Q4S-4JTSGG+M3TT (8167175)
  • Valve terminal VTUG-14-MSDR-B1TZ-25V20-Q8-U-Q4S-JJTSGG+M3TT (8167176)
  • Valve terminal VTUG-14-MSDR-B1TZ-44V21-Q12A-U-Q6S-8JKQ4KQ4KQ4KQ4KQ4TS3VN+M2 (8231027)
  • Valve terminal VTUG-14-MSDR-B1TZ-44V21-Q12A-U-Q6S-8JKQ4KQ4KQ4KQ4KQ4TS3VN+M3 (8231028)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10LA-UL-Q6S-8J+M2TT (8167177)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10LA-UL-Q6S-9J+M2TT (8184738)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10LA-UL-Q6SFA-4J+M2TV (8167178)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10LA-UL-Q6SFC-7JQ8JQ8JQ8+M3TT (8170996)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10LA-UR-Q6SFC-5J+M3TT (8170997)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10L-UL-Q6S-6J+M3TT (8184739)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10L-UL-Q6S-8J+M2TT (8167179)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10L-UL-Q8S-3JQ6JQ6+M2TT (8167180)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10L-UR-Q6S-4J+M2TT (8170998)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10L-UR-Q8S-5J+M3TT (8167181)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10R-UR-Q6S-3JG+M2TT (8170999)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10R-UR-Q6S-8J+M2TT (8171000)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10-U-Q6S-4G+M2TT (8171001)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q10-U-Q6SFA-4G+M3TV (8184740)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12LA-UL-Q6S-8J+M2TT (8171005)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12LA-UL-Q6S-8J+M2TT (8171006)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12LA-U-Q6S-5JK+M3TT (8167182)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12LA-UR-Q6S-6KJJ+M3TT (8167183)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12LA-UR-Q6SFC-4J+M3TT (8167184)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12L-UL-Q8S-4J+M2TT (8167185)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12RA-UL-Q6SFC-4J+M3TT (8167186)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12RA-UL-Q6SFC-5J+M3TT (8171002)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q12RA-UR-Q6S-8K+M2TT (8171003)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q8A-U-Q4SFC-5J+M2 (8167187)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q8LA-UL-Q8SFC-KK3JQ6+M3TT (8167188)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q8L-UR-Q8S-6E (8176180)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q8-U-Q6SFA-6G8MLL+M3TV (8171004)
  • Valve terminal VTUG-14-MSDR-S1T-25V20-Q8-U-Q8S-JJTSKK+M3TT (8167189)
  • Valve terminal VTUG-14-MSDR-S1T-25V22-Q12L-UR-Q6S-6G+M2TT (8167190)
  • Valve terminal VTUG-14-MSDR-S1TZ-25V20- :SM (8196007)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-G14-U-Q6S-13A3L+M2 (8199506)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-Q8-DT-Q8S-3K4G (8188912)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-UL-T14S-3JMM (8176260)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-UL-T14S-4JMM (8176259)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-UL-T14S-EE3J5M (8176262)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-UL-T14S-EELCCLCC (8176264)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-UL-T14S-J3M (8176265)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-UL-T14S-MMLCCLCC (8176269)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-U-T14S-3JM3JM (8176247)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-U-T14S-6JLCCLCC (8176258)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-U-T14S-6M (8176256)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-U-T14S-EEJ5M (8176250)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-U-T14S-JJ4M (8176257)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38L-U-T14S-JJMJJM (8176246)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-UL-T14S-3MTPG (8176253)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-UL-T14S-3MTPM (8176252)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-UL-T14S-4METPM (8176255)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-UL-T14S-JMLCCTPM (8176254)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-UL-T14S-MMLCCTPG (8176251)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-UL-T14S-MMLCCTPM (8176245)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-UL-T14S-MMTPMM (8176249)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-U-T14S-3JEETPG (8176267)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-U-T14S-EJJTPG (8176263)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-U-T14S-JEJMLCCTPJ (8176268)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-U-T14S-JJEMLCCTPJ (8176266)
  • Valve terminal VTUG-14-MSDR-S8-B1T-25V20-T38-U-T14S-MMTPSMMTPM (8176248)
  • Valve terminal VTUG-14-MSDR-S8-B1TZ-25V20-G14-DT-G18S-3G3A+TT:SM (8165783)
  • Valve terminal VTUG-14-MSDR-S8-B1TZ-25V20-G14-DT-G18S-3G3AL+TT+:SM (8146514)
  • Valve terminal VTUG-14-MSDR-S8-S1T-25V20-Q8-U-Q8S-ATPASAATPAA+MA1TT (8185322)
  • Valve terminal VTUG-14-SR8-S1T-G14L-DTL-Q6S-VDVD+HN3+* (5329371)
  • Valve terminal VTUG-14-VRAP-B1T-G14-DT-G18S-13VK3L (8183111)
  • Valve terminal VTUG-14-VRAP-B1T-G14-DT-G18S-20J4VK (8183112)
  • Valve terminal VTUG-14-VRAP-B1T-G14-DT-G18S-8VKLL (8183110)
  • Valve terminal VTUG-14-VRAP-B1T-G14-DTR-G18S-3M7JLL (8217016)
  • Valve terminal VTUG-14-VRAP-B1T-G14L-DTL-G18S-12VK (8191451)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-3EJ (8139987)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-3EJ (8140151)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-3GL (8144973)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-4G (8140295)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-6EGGLL (8140296)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-6G (8144974)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-6GEL (8140298)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-6GLL (8140299)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-GGLL (8144975)
  • Valve terminal VTUG-14-VRAP-B1T-Q10LA-UL-Q6S-GQ87GJJ (8140302)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q4S-4G (8140377)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q4S-4JQ6G4JQ6G (8140378)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-10J (8150970)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-12J (8139985)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-16J4L (8151001)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-18JLL (8150971)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-19JL (8150972)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-3GJJMQ4JQ4GQ4GQ4L (8140494)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-3J3E (8140152)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-3J4GE (8139986)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-3J5G (8139984)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-4GJQ4JQ4GGJJ (8140496)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-4JLL (8150973)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-5JL (8150990)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-6AJJ (8182838)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-6GQ8 (8140502)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-6GQ8 (8140503)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-6JLL (8150991)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-7GQ4JQ4JQ4JQ4 (8140504)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-8J (8182837)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-8JLL (8150992)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-EEGJ (8140505)
  • Valve terminal VTUG-14-VRAP-B1T-Q10L-UL-Q6S-GJJGQ4GQ4JQ4GQ83G (8144978)
  • Valve terminal VTUG-14-VRAP-B1T-Q10RA-UR-Q6S-4G (8140506)
  • Valve terminal VTUG-14-VRAP-B1T-Q10RA-UR-Q6S-LLGGQ8 (8140508)
  • Valve terminal VTUG-14-VRAP-B1T-Q10R-UR-Q6S-GQ85G (8140509)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q6S-10A (8182840)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q6S-10J (8182842)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q6S-12A (8182843)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q6S-5G5J (8140510)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q6S-7A3J (8182839)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q6S-8A4J (8182844)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q6S-8AJJ (8182841)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q6S-AA10J (8182846)
  • Valve terminal VTUG-14-VRAP-B1T-Q10-U-Q8S-10GLL+H (8173519)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18S-10MLL (8175128)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18S-8G8M (8175135)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18S-GGEEMM (8175125)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18S-GGEEMMJJ (8175126)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18S-GGEEMMJJLL (8175127)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18SU-10MLL (8175157)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18SU-8G8M (8175158)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18SU-GGEEMM (8175139)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18SU-GGEEMMJJ (8175140)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18SU-GGEEMMJJ (8175141)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-DT-G18SU-GGEEMMJJLL (8175156)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-U-Q4S-13MQ6MQ6MQ6MQ6 (8191452)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-U-Q4S-9JQ8JQ8JQ8JQ8JQ83L (8140511)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-U-Q4S-JQ8JQ84J (8140512)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-U-Q6S-16M (8191453)
  • Valve terminal VTUG-14-VRAP-B1T-Q12A-U-Q6S-8JL (8150993)
  • Valve terminal VTUG-14-VRAP-B1T-Q12B-UB-Q8SU-3EG (8140574)
  • Valve terminal VTUG-14-VRAP-B1T-Q12L-UL-Q6S-20J4L (8150994)
  • Valve terminal VTUG-14-VRAP-B1T-Q12-U-Q6S-10A (8156882)
  • Valve terminal VTUG-14-VRAP-B1T-Q12-U-Q6S-12J (8156881)
  • Valve terminal VTUG-14-VRAP-B1T-Q12-U-Q6S-16J (8156880)
  • Valve terminal VTUG-14-VRAP-B1T-Q12-U-Q6S-20G (8156879)
  • Valve terminal VTUG-14-VRAP-B1T-Q12-U-Q6S-24G (8156878)
  • Valve terminal VTUG-14-VRAP-B1T-Q12-U-Q6S-4A (8156885)
  • Valve terminal VTUG-14-VRAP-B1T-Q12-U-Q6S-6A (8156884)
  • Valve terminal VTUG-14-VRAP-B1T-Q12-U-Q6S-8A (8156883)
  • Valve terminal VTUG-14-VRAP-B1T-Q8LA-UL-Q6S-LLGG (8140576)
  • Valve terminal VTUG-14-VRAP-B1T-Q8L-UL-Q4S-4K (8140578)
  • Valve terminal VTUG-14-VRAP-B1T-Q8-U-Q6S-10JTSJJ (8217245)
  • Valve terminal VTUG-14-VRAP-B1T-Q8-U-Q6S-11GS11GL+H (8173518)
  • Valve terminal VTUG-14-VRAP-B1T-Q8-U-Q6S-8J (8217243)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DQ-Q4S-LL16VNLL (8141453)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-11MN (8217238)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-12M (8217242)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-12MLLNN (8217244)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-12VK (8217247)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-13MLLH (8217236)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-16VK (8217246)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-20M (8217251)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-3VKTP3VK (8217257)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-4VKTS5VKS5VKS4VK (8217239)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-4VKTS5VKS5VKS8VK (8217249)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-4VKTS5VKS6VK (8217248)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-5VKTS4VKS5VKS4VK (8217259)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-6VN (8217235)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-7ML (8217237)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-8K (8217258)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-8VK (8217253)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-8VN (8217250)
  • Valve terminal VTUG-14-VRAP-B1TZ-G14-DT-Q8S-MTSSMTSM (8217240)
  • Valve terminal VTUG-14-VRAP-B1TZ-Q10-DQ-Q4S-LL20VNLL (8141455)
  • Valve terminal VTUG-14-VRAP-B1TZ-Q10-U-Q6S-10VKLL (8178099)
  • Valve terminal VTUG-14-VRAP-B1TZ-Q10-U-Q6S-4VK4J4L+H (8178826)
  • Valve terminal VTUG-14-VRAP-S1T-Q10LA-UL-Q6S-4GEL (8144979)
  • Valve terminal VTUG-14-VRAP-S1T-Q10LA-UL-Q6S-6GQ83JQ8L (8144980)
  • Valve terminal VTUG-14-VRAP-S1T-Q10LA-UL-Q6SFA-EELL (8140579)
  • Valve terminal VTUG-14-VRAP-S1T-Q10-U-Q6S-KK8J (8171007)
  • Valve terminal VTUG-14-VRAP-S1T-Q12A-U-Q6S-14GLL (8150773)
  • Valve terminal VTUG-14-VRAP-S1T-Q12A-U-Q6S-15GL (8150764)
  • Valve terminal VTUG-14-VRAP-S1T-Q12A-U-Q6S-LL16GLL (8150763)
  • Valve terminal VTUG-14-VRAP-S1T-Q12LA-UL-Q6S-4G (8144981)
  • Valve terminal VTUG-14-VRAP-S1T-Q12LA-UL-Q8S-5GL (8144982)
  • Valve terminal VTUG-14-VRAP-S1T-Q8L-UL-G18S-4G (8140596)
  • Valve terminal VTUG-14-VRAP-S1T-Q8L-UL-Q6S-4G (8171008)
  • Valve terminal VTUG-14-VRAP-S1T-Q8L-UL-Q6S-K5J (8171009)
  • Valve terminal VTUG-14-VRAP-S1TZ-Q10A-DT-Q4S-4VK4LTSGQ6GQ6GQ6GQ6GQ6GQ6GQ6GQ6 (8150775)
  • Valve terminal VTUG-14-VRAP-S1TZ-Q10A-DT-Q4S-6VKLLTSLLGQ6GQ6GQ6GQ6GQ6GQ6GQ6GQ6GQ6GQ6 (8150772)
  • Valve terminal VTUG-14-VRAP-S1TZ-Q10A-U-Q4S-12VK (8150767)
  • Valve terminal VTUG-14-VRAP-S1TZ-Q10A-U-Q6SFA-4GJMTSVK (8140597)
  • Valve terminal VTUG-14-VRAP-S1TZ-Q8A-DT-Q4S-6G4L6G (8150774)
  • Valve terminal VTUG-14-VRAP-S1TZ-Q8A-DT-Q4S-7GLL7G (8150768)
  • Valve terminal VTUG-14-VRAP-S8-B1T-Q10A-U-Q6S-3AXCCAXR1JLCCLCCTPACCXQ6STPASTPAQG18AQG183AQG18AKXCCAQG18LCCLCCSTPKKXCC+TT (8216909)
  • Valve terminal VTUG-14-VRAP-S8-B1T-Q10A-U-Q6S-3AXCCAXR1JLCCLCCTPACCXQ6STPASTPAQG18AQG183AQG18AKXCCAQG18LCCLCCSTPKKXCC+TT (8227089)
  • Valve terminal VTUG-14-VRAP-S8-B1T-Q10A-U-Q6S-NQG18XQG18K3AQG18XQG18TPSACCXQ6TPA+TT (8216910)
  • Valve terminal VTUG-14-VRAP-S8-B1T-Q10A-U-Q6S-NQG18XQG18K3AQG18XQG18TPSACCXQ6TPA+TT (8227086)
  • Valve terminal VTUG-14-VRAP-S8-B1T-Q12A-U-Q6S-3AXQG18AXR1JLLTPASTPASTPAQG18AQG183AQG18AKAQG18LLSTPKK+TT (8207254)
  • Valve terminal VTUG-14-VRAP-S8-B1T-Q12A-U-Q6S-NQG18XQG18K3AQG18XQG18TPSACCXQ6TPA+TT (8207255)
  • Valve terminal VTUG-14-VRLK- +TT+:SM (8163252)
  • Valve terminal VTUG-14-VRLK- KQ8JQ4LQG18:SM (8162007)
  • Valve terminal VTUG-14-VRLK- QDAXR1:SM (8161960)
  • Valve terminal VTUG-14-VRLK-16E2AP-B1T-G14-U-Q6S-J4A3VK (8210779)
  • Valve terminal VTUG-14-VRLK-16E2AP-B1T-G14-U-Q6S-J4A3VK (8210781)
  • Valve terminal VTUG-14-VRLK-16E2AP-B1T-G14-U-Q8S-7JVK (8210782)
  • Valve terminal VTUG-14-VRLK-8EP-B1T-G14L-U-Q8S-EAQ6LCCLCC (8210780)
  • Valve terminal VTUG-14-VRLK-B1T-G14-DT-G18S-12A (8199601)
  • Valve terminal VTUG-14-VRLK-B1T-G14-DT-G18S-4GAA5JVK (8188584)
  • Valve terminal VTUG-14-VRLK-B1T-G14-DT-G18S-4J (8199597)
  • Valve terminal VTUG-14-VRLK-B1T-G14-DT-G18S-5A5K (8199600)
  • Valve terminal VTUG-14-VRLK-B1T-G14-DT-G18S-6A (8199598)
  • Valve terminal VTUG-14-VRLK-B1T-G14-DT-G18S-8A8E (8199602)
  • Valve terminal VTUG-14-VRLK-B1T-G14-DT-G18S-8G (8199599)
  • Valve terminal VTUG-14-VRLK-B1T-G14L-U-G18S-16G (8150595)
  • Valve terminal VTUG-14-VRLK-B1T-G14L-U-G18S-9G (8150596)
  • Valve terminal VTUG-14-VRLK-B1T-G14-U-G18S-4JML (8191454)
  • Valve terminal VTUG-14-VRLK-B1T-G14-UR-G18S-EKJCCXQG18XFGJCCXQG18XFG (8202327)
  • Valve terminal VTUG-14-VRLK-B1T-Q10A-U-Q8S-18K6J (8174679)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-11J5VK (8170229)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-12J (8170198)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-13J3VK (8170271)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-14JLL (8170214)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-14JVKVK (8170230)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-15JE (8170197)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-15JL (8170196)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-3JGJG3J4L3VK (8170231)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-4AGG4A (8170206)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-4G11JVK (8170245)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-4G4J4A (8170212)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-4G6JEE (8170219)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-4J3GEE7J (8170195)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-6JLL (8170215)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-6JVK4JL (8170216)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-7JTP3K (8170272)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-8A (8170236)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-8GJJEE (8170222)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-8J (8170298)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-9J4L3VK (8170232)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-9JLVKVK (8170217)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-G10JA (8170207)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-GG4J4A (8170246)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-GG6J4A (8170239)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-JJVKL4JLVKVKL (8170218)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q6S-L12J3VK (8170199)
  • Valve terminal VTUG-14-VRLK-B1T-Q10-DT-Q8SU-16A+SC (8186205)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-DT-Q6S-10J (8170200)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-DT-Q6S-12J (8170213)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-DT-Q6S-12JK3L (8170299)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-DT-Q6S-16J (8170194)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-DT-Q6S-4G7JVK (8170202)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-DT-Q6S-8J (8170201)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-10J (8174592)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-12J (8163421)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-14JLL (8174593)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-18JLL (8163420)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-3J3L (8188497)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-4JLL (8163417)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-5JL (8163438)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-6JLL (8174594)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UL-Q6S-8JLL (8188498)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-U-Q6S-16G (8170266)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-U-Q6S-5G (8170268)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-U-Q6S-9G (8170240)
  • Valve terminal VTUG-14-VRLK-B1T-Q10L-UR-Q6S-3GL (8170227)
  • Valve terminal VTUG-14-VRLK-B1T-Q10RA-UR-Q6S-MQ4MXQ8MXQ8LMQ4L (8176747)
  • Valve terminal VTUG-14-VRLK-B1T-Q10R-UL-Q6S-LLGG (8170247)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18S-10MLL (8175174)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18S-8G8M (8175175)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18S-GGEEMM (8175171)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18S-GGEEMMJJ (8175172)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18S-GGEEMMJJLL (8175173)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18SU-10MLL (8175181)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18SU-8G8M (8175182)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18SU-GGEEMM (8175176)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18SU-GGEEMMJJ (8175179)
  • Valve terminal VTUG-14-VRLK-B1T-Q12A-DT-G18SU-GGEEMMJJLL (8175180)
  • Valve terminal VTUG-14-VRLK-B1T-Q12LA-UL-Q6S-3JAA3JLL (8191455)
  • Valve terminal VTUG-14-VRLK-B1T-Q12LA-UR-G18S-EKJCCXQG18XFGJCCXQG18XFG (8189269)
  • Valve terminal VTUG-14-VRLK-B1T-Q12L-UL-Q6S-20J4L (8163418)
  • Valve terminal VTUG-14-VRLK-B1T-Q12L-UL-Q8S-14JLL (8213718)
  • Valve terminal VTUG-14-VRLK-B1T-V1-Q10FD-UFD-Q6SFD-5K3L+SCVA (8224947)
  • Valve terminal VTUG-14-VRLK-B1T-V1-Q10FD-UFD-Q6SFD-8K+SCVA (8224946)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10-DQ-Q6S-5AQ4AQ4VKQ4VKQ45A8VKLSTSKQ8 (8188469)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10-DQ-Q6S-5AQ4AQ4VKQ4VKQ45A8VKLSTSVKQ8 (8192712)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10-DQ-Q6S-5AQ4AQ4VKQ4VKQ4L5A8VKSTSKQ8 (8185565)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10L-DT-Q6S-16J (8170248)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10L-DT-Q6S-5JE4J (8170249)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10L-DT-Q8S-5J9MLL (8170224)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10L-DT-Q8S-8J (8170273)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10L-UL-Q6S-3VKL (8240248)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10L-U-Q8S-6J (8184235)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10L-U-Q8S-JMKJJM (8184236)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10R-DT-Q6S-8J (8170250)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10R-DT-Q6S-JJ4G (8170251)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10R-DT-Q8S-12J (8170274)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10R-DT-Q8S-16J (8170275)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q10R-DT-Q8S-6J (8170276)
  • Valve terminal VTUG-14-VRLK-B1TZ-Q12-U-Q6S-8VKLQ4LQ4LQ4L (8180963)
  • Valve terminal VTUG-14-VRLK-S1T-G14L-DTL-G18S-G5MLL (8191456)
  • Valve terminal VTUG-14-VRLK-S8-B1H-G14L-DTL-G18S-EKLCCLCC (8206962)
  • Valve terminal VTUG-14-VRLK-S8-B1H-G14-UR-G18S-EKJCCXQG18XFGJCCXQG18XFG (8206961)
  • Valve terminal VTUG-14-VRLK-S8-B1T-G14-DT-G18S-AVKLTSG (8202231)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-10JLL (8170208)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-11J5L (8170220)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-13J3L (8170226)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-14JLL (8170209)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-16J (8170210)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-3L10JGJJ (8170203)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-5JEE8JL (8170223)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-5JEE9J (8170211)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-7JL (8170204)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-JKEE3JEGG6J (8170205)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10-DT-Q6S-K6JK8J (8170221)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10FDA-UFD-Q8SFDSH-16K8J+SC (8163979)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10L-DT-Q6S-10G6J (8170252)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10L-DT-Q6S-14JLL (8170234)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10L-DT-Q6S-16J (8170253)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10L-DT-Q6S-7J5G4J (8170254)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10L-DT-Q6S-7J8GJ (8170235)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10L-DT-Q6S-8J (8170255)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10L-DT-Q6S-8J6GJJ (8170256)
  • Valve terminal VTUG-14-VRLK-S8-B1T-Q10L-DT-Q6S-G7J (8170257)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ- G18:SM (8132930)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ- QG18:SM (8132931)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-10J (8170258)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-11JEEKK5L (8170277)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-3J3KJKJJLL (8170278)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-3J4E5KE3L (8170279)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-3JE4L (8170280)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-3JEE7L (8170281)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-4AEVKVKA (8170287)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-4J (8170259)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-4JEEJVKEEVKJ4L (8170288)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-4JLL (8170260)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-5GEEVKLL (8170241)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-6JEEJVKEEJVKLL (8170289)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-8J (8170261)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-8J4L (8170282)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-8MEE5KL (8170300)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-AA5VKAA3VK (8170290)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-JJ3KJKJJKJJKJLL (8170283)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-VK10AL (8170291)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10-DT-Q8S-VKVKAA5VK3L (8170292)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10L-DT-Q8S-16J (8170284)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10L-DT-Q8S-4G (8170262)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10L-DT-Q8S-4J4G (8170263)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10L-DT-Q8S-5G3L (8170285)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10L-DT-Q8S-6G (8170264)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10L-DT-Q8S-8G (8170265)
  • Valve terminal VTUG-14-VRLK-S8-B1TZ-Q10L-DT-Q8S-JEJJE8J3L (8170293)
  • Valve terminal VTUG-14-VRPT-B1T-G14-DT-G18S-3MKMKMKMKGG (8183371)
  • Valve terminal VTUG-14-VRPT-B1T-G14-DT-G18S-3MKMKMKMKML (8183372)
  • Valve terminal VTUG-14-VRPT-B1T-G14-DT-G18S-KK4GJL (8183373)
  • Valve terminal VTUG-14-VRPT-B1T-G14L-DTL-G18S-3JG (8170869)
  • Valve terminal VTUG-14-VRPT-B1T-Q10A-U-Q8S-18K6J (8174680)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-DT-Q4S-8KAQ6LQ6LQ6LLQ6LCCLCCLCC (8191542)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-UL-Q6S-6G (8140598)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-UL-Q6S-GGLL (8144983)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q6S-11GK (8219495)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q6S-14GLL (8219496)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q6S-23GL (8219497)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q6S-6GLL (8219498)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q8S-12GKKLL (8219499)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q8S-16G6EKL (8219500)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q8S-17G4E3L (8205016)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q8S-18G4KLL (8219501)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q8S-4E4KLL (8219502)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q8S-4GKKLL (8219503)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q8S-4GLL (8219504)
  • Valve terminal VTUG-14-VRPT-B1T-Q10LA-U-Q8S-7G4KL (8219505)
  • Valve terminal VTUG-14-VRPT-B1T-Q10L-UL-Q6S-GJJGQ4GQ4JQ4GQ83G (8140599)
  • Valve terminal VTUG-14-VRPT-B1T-Q10L-U-Q6S-7GKLL (8205017)
  • Valve terminal VTUG-14-VRPT-B1T-Q10L-UR-Q6S-5ML (8178967)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q4S-14G6L (8219506)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q4S-6GLL (8219507)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-10GLL (8219508)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-11GKK3L (8205018)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-12GKKLL (8205019)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-13G3L (8205020)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-15JL (8170228)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-16G4L (8219509)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-20G4L (8219510)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-3G4E3L (8205038)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-3GEE3L (8205026)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-3GJ7GKG3L (8205021)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-4GKKLL (8205027)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-4GLCCLCC (8219511)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-5G3L (8219512)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-5GE4L (8205039)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-5GLCCLCCLCC (8219513)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-6GKL (8219514)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-6GLCCLCC (8219516)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-7G3L (8219517)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-8GLL (8219554)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-9G3L (8205028)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-GEGGLL (8205040)
  • Valve terminal VTUG-14-VRPT-B1T-Q10-U-Q6S-J3G3J3G4JKGJ3L (8205029)
  • Valve terminal VTUG-14-VRPT-B1T-Q12LA-U-Q8S-10GLL (8205022)
  • Valve terminal VTUG-14-VRPT-B1T-Q12RA-UR-Q6S-KQ8KQ8KQ8XQ6KGGJJKL (8240249)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-10A (8156874)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-12J (8156873)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-13GKLL (8219556)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-16J (8156872)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-20G (8156870)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-24G (8156868)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-4A (8156877)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-6A (8156876)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-6GK3L (8219557)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-8A (8156875)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-8GLL (8219558)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-9G3L (8219559)
  • Valve terminal VTUG-14-VRPT-B1T-Q12-U-Q6S-EJQ4JQ4EQ4EQ4JQ4JQ4LCCLCCLCC (8205023)
  • Valve terminal VTUG-14-VRPT-B1T-Q8-U-Q6S-4GLL (8219560)
  • Valve terminal VTUG-14-VRPT-B1T-Q8-U-Q6S-4J (8185640)
  • Valve terminal VTUG-14-VRPT-B1T-T38L-UL-T516S-16K+H (8212157)
  • Valve terminal VTUG-14-VRPT-S1T-T38L-UL-T14S-8K (8203343)
  • Valve terminal VTUG-14-VRPT-S1T-T38-U-T14S-12J (8203344)
  • Valve terminal VTUG-14-VRPT-S8-B1H-Q10FD-UFD-Q8SFD-12VK+SCEX2E (8182054)
  • Valve terminal VTUG-14-VRPT-S8-B1H-Q10FD-UFD-Q8SFD-16VK+SCEX2E (8182055)
  • Valve terminal VTUG-14-VRPT-S8-B1H-Q10FD-UFD-Q8SFD-24J+SCEX2E (8182057)
  • Valve terminal VTUG-14-VRPT-S8-B1H-Q10FD-UFD-Q8SFD-24VK+SCEX2E (8182056)
  • Valve terminal VTUG-14-VRPT-S8-B1T-Q10FD-UFD-Q8SFD-15K9J+SCEX2E (8165577)
  • Valve terminal VTUG-14-VRPT-S8-B1T-Q10FD-UFD-Q8SFD-18M6J+SCEX2E (8163980)
  • Valve terminal VTUG-14-VRPT-S8-B1T-Q10-U-Q6S-11G5L (8205042)
  • Valve terminal VTUG-14-VRPT-S8-B1T-Q12A-UL-Q8S-8K (8184237)
  • Valve terminal VTUG-14-VRPT-S8-B1T-T38-U-T14S-16K (8186511)
  • Valve terminal VTUG-14-VRPT-S8-S1T-Q8-U-Q6S-8VK+TT (8217255)
  • Valve terminal VTUG-16V-HOTSWAP (8105152)
  • Valve terminal VTUG-18-G-B1T-G38-DT-G14S-JGEJGE (8189039)
  • Valve terminal VTUG-18-MSD-B1T-25V20-G38-DT-G14SU-4P (8159001)
  • Valve terminal VTUG-18-MSD-B1T-25V20-G38R-DT-G14S-9J+M1 (8176482)
  • Valve terminal VTUG-18-MSD-B1T-25V20-G38-U-Q10S-JQ6AQ6JQ8TPJTRJ+M3 (8176766)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-U-G14S-BBJJ+M1 (8176770)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-UL-Q10S-4G+M2TT (8184742)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-UL-Q10S-4JQ8JQ8+M2TT (8171010)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-UL-Q10S-5JQ8+M2TT (8171011)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-UL-Q10S-9JQ8JQ8+M2TT (8171012)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-U-Q10S-3GKQ8KQ8+M3TT (8184743)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-U-Q10S-E4GKQ8KQ8+M3TT (8167191)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-U-Q10S-JQ6XCCJQ6XCCJJTRGXCCGXCC (8171013)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-U-Q6S-AJJA+M3 (8176765)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12LA-UR-Q8S-6J (8203568)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12L-UL-Q8S-4J+M2TT (8184741)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12L-U-Q6S-EQ10EQ108A+M2 (8176764)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12L-U-Q8S-AJQ10JQ6AQ6AQ6+M3 (8176768)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12L-UR-Q8S-5JQ10+M1TT (8171014)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12RA-UR-Q6S-7JKK+M3TT (8184744)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12RA-UR-Q8S-3JQ10JQ10JQ10JQ10+M1TT (8184745)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12R-U-Q8S-6K6J+M3TT (8231030)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12R-UR-Q10S-4J+M1TT (8171015)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12R-UR-Q8S-4J+M2TT (8167192)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q12-U-Q6S-P6JQ8JQ10PJQ8+M3 (8176769)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q16L-UL-Q8S-KQ6KQ6KQ6JQ6JQ6JQ6J+M3TT (8171016)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q16R-UR-Q6S-KK3JGQ10+M2TT (8171017)
  • Valve terminal VTUG-18-MSD-B1T-25V20-Q8RA-UR-Q6S-JAJJL+M2 (8199270)
  • Valve terminal VTUG-18-MSD-B1T-44V21-Q12A-U-Q6S-JQ8JQ8JQ88JQ83JAQ10GQ10 (8176767)
  • Valve terminal VTUG-18-MSD-B1T-44V21-Q12-U-Q8S-16K+M3TT (8167193)
  • Valve terminal VTUG-18-MSD-S1T-25V20-Q12LA-UL-Q10S-6J+M2TT (8171018)
  • Valve terminal VTUG-18-MSD-S1T-25V20-Q12LA-UL-Q10S-6J+M2TV (8171019)
  • Valve terminal VTUG-18-MSD-S1T-25V20-Q16R-UL-Q6SFB-KQ10XQ6KQ10XQ6KQ10XQ6KQ10XQ6KQ10XQ6KQ10XQ66K+M1TV (8171063)
  • Valve terminal VTUG-18-MSD-S1T-44V21-Q12-U-Q8S-16K+M3TT (8236508)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-G38L-DTR-G14S-4G+M1 (8176484)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-G38L-DTR-G14S-4J+M1 (8176485)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-G38L-DTR-G14S-8J+M2 (8176487)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-G38L-DTR-G14S-AALL+M2 (8176488)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-G38L-DTR-G14S-GGLL+M1 (8176483)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-G38L-DTR-G14S-JJLL+M1 (8176486)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-T12-U-T38S-LL3P (8186510)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-T38-U-T14S-5PCCXT38TPP (8176244)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-T38-U-T38S-EJPPT14LCCTPP (8176261)
  • Valve terminal VTUG-18-MSD-S8-B1T-25V20-T38-U-T38S-PXCCTP4P (8176243)
  • Valve terminal VTUG-18-VAP-B1T-G38-DTR-G14S-4A4JGGLL (8217340)
  • Valve terminal VTUG-18-VAP-B1T-G38L-DTL-G14S-EG3ELL (8191472)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-DT-G14S-10PLL (8175164)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-DT-G14S-GGEEPP (8175159)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-DT-G14S-GGEEPPJJ (8175162)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-DT-G14S-GGEEPPJJLL (8175163)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-DT-G14SU-10PLL (8175170)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-DT-G14SU-GGEEPP (8175167)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-DT-G14SU-GGEEPPJJ (8175168)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-DT-G14SU-GGEEPPJJLL (8175169)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-U-Q8S-8G (8140600)
  • Valve terminal VTUG-18-VAP-B1T-Q12A-U-Q8S-GQ105GJJ (8140601)
  • Valve terminal VTUG-18-VAP-B1T-Q12L-DTL-Q6S-8J (8176332)
  • Valve terminal VTUG-18-VAP-B1T-Q12-U-Q6S-10J (8156864)
  • Valve terminal VTUG-18-VAP-B1T-Q12-U-Q6S-12J (8156863)
  • Valve terminal VTUG-18-VAP-B1T-Q12-U-Q6S-16J (8156862)
  • Valve terminal VTUG-18-VAP-B1T-Q12-U-Q6S-20G (8156861)
  • Valve terminal VTUG-18-VAP-B1T-Q12-U-Q6S-24G (8156857)
  • Valve terminal VTUG-18-VAP-B1T-Q12-U-Q6S-4A (8156867)
  • Valve terminal VTUG-18-VAP-B1T-Q12-U-Q6S-6A (8156866)
  • Valve terminal VTUG-18-VAP-B1T-Q12-U-Q6S-8A (8156865)
  • Valve terminal VTUG-18-VAP-B1T-Q16L-DTL-CS-JQ10JQ10PQ6JQ10JQ10PQ6JXQ6L (8176334)
  • Valve terminal VTUG-18-VAP-B1T-Q16L-DTL-CS-JXQ6JXQ6JXQ6JXQ6JXQ6JXQ6JXQ6 (8176333)
  • Valve terminal VTUG-18-VAP-B1T-Q16L-DTL-CS-JXQ6JXQ6JXQ6JXQ6JXQ6JXQ6JXQ6JXQ6 (8176331)
  • Valve terminal VTUG-18-VAP-B1T-Q16L-DTL-CS-JXQ6JXQ6JXQ6JXQ6JXQ6JXQ6JXQ6JXQ6LL (8176397)
  • Valve terminal VTUG-18-VAP-B1TZ-Q12-U-Q8S-10VKLL (8178100)
  • Valve terminal VTUG-18-VAP-S1T-Q12A-U-Q6S-4GL (8150766)
  • Valve terminal VTUG-18-VLK-B1T-G38-DT-G14S-EEJ5VK (8188512)
  • Valve terminal VTUG-18-VLK-B1T-G38-U-G14S-4J (8191473)
  • Valve terminal VTUG-18-VLK-B1T-Q12A-DT-G14S-10PLL (8175208)
  • Valve terminal VTUG-18-VLK-B1T-Q12A-DT-G14S-GGEEPP (8175183)
  • Valve terminal VTUG-18-VLK-B1T-Q12A-DT-G14S-GGEEPPJJ (8175204)
  • Valve terminal VTUG-18-VLK-B1T-Q12A-DT-G14S-GGEEPPJJLL (8175206)
  • Valve terminal VTUG-18-VLK-B1T-Q12A-DT-G14SU-10PLL (8175213)
  • Valve terminal VTUG-18-VLK-B1T-Q12A-DT-G14SU-GGEEPP (8175209)
  • Valve terminal VTUG-18-VLK-B1T-Q12A-DT-G14SU-GGEEPPJJ (8175210)
  • Valve terminal VTUG-18-VLK-B1T-Q12A-DT-G14SU-GGEEPPJJLL (8175211)
  • Valve terminal VTUG-18-VLK-B1T-Q12LA-DT-Q8S-GXCCGXCCGXCCGXCCGXCCGXCCGXCCGXCCGXCCGXCCGXCCL (8191474)
  • Valve terminal VTUG-18-VLK-B1T-Q12L-U-Q6S-11KL+H (8150995)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q10S-7GLTPKQ6KQ6KQ6KQ6KQ6KQ6LL+H (8150996)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q6S-10J (8156856)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q6S-12J (8156855)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q6S-16J (8156854)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q6S-20G (8156853)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q6S-24G (8156852)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q6S-4A (8156858)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q6S-6A (8156859)
  • Valve terminal VTUG-18-VLK-B1T-Q12-U-Q6S-8A (8156860)
  • Valve terminal VTUG-18-VLK-B1TZ-G38-DT-G14S-5JAA4JL (8188511)
  • Valve terminal VTUG-18-VLK-B1TZ-G38-DT-G14S-9J4VK3L (8188513)
  • Valve terminal VTUG-18-VLK-B1TZ-Q10LA-DTL-Q8S-GXCCGXCCGXCCGCCXQ8GCCXQ8GCCXQ8LL (8191475)
  • Valve terminal VTUG-18-VLK-B1TZ-Q12LA-UR-CS-AXQ8AXQ8AXQ8AXQ8AXQ8AXQ8AXQ8AXQ8AXQ8AXQ8 (8191476)
  • Valve terminal VTUG-18-VLK-B1TZ-Q12R-DT-Q8S-4J (8170225)
  • Valve terminal VTUG-18-VLK-S1T-Q10-U-Q10S-10E (8224856)
  • Valve terminal VTUG-18-VLK-S8-B1TZ-Q12-DT-Q8S-EEK5L (8170286)
  • Valve terminal VTUG-18-VPT-B1T-Q10L-UR-Q8S-JLKL (8191541)
  • Valve terminal VTUG-18-VPT-B1T-Q12L-DQL-Q6S-A3EQ10EQ8 (8172794)
  • Valve terminal VTUG-18-VPT-B1T-Q12R-UR-Q6S-12J (8224836)
  • Valve terminal VTUG-18-VPT-B1T-Q12R-UR-Q6S-12P (8224837)
  • Valve terminal VTUG-18-VPT-B1T-Q12-U-Q8S-12E4L (8205041)
  • Valve terminal VTUG-18-VPT-B1T-Q12-U-Q8S-12G4L (8219561)
  • Valve terminal VTUG-18-VPT-B1T-T12-DQ-T38S-PTSPPLCC (8186509)
  • Valve terminal VTUG-18-VPT-S8-B1H-G38-DT-G14S-3KL4J4G4L (8183377)
  • Valve terminal VTUG-18-VPT-S8-B1H-G38-DT-G14S-3KLJJEE4G4L (8183378)
  • Valve terminal VTUG-18-VPT-S8-B1H-G38-DT-G14S-KK4GJL (8183374)
  • Valve terminal VTUG-18-VPT-S8-B1H-G38-DT-G14S-KKLL6GLL (8183376)
  • Valve terminal VTUG-18-VPT-S8-B1H-T12-DQ-T14S-10PLCCLCC (8186504)
  • Valve terminal VTUG-18-VPT-S8-B1H-T12-DQ-T14S-HHTP6PLCCLCC (8186505)
  • Valve terminal VTUG-18-VPT-S8-B1H-T12-DQ-T14S-HT38PHT38PHT38PHT38PLCCLCC (8186508)
  • Valve terminal VTUG-18-VPT-S8-B1HZ-T12-DQ-T14S-PCCXT14PCCXT14PCCXT144KLCC (8186506)
  • Valve terminal VTUG-18-VPT-S8-B1TZ-G38-DT-T38S-AAT143AT14AT14AT14AT14AT14AT14AT14AT14AT14AT14AAT14AXCCLCCTSLCC5ACCXQG14 (8216033)
  • Valve terminal VTUG-18-VPT-S8-B1TZ-G38-U-Q6S-11ALLTSSPPTP6ALL (8216034)
  • Valve terminal VTUG-24V-HOTSWAP (8105153)
  • Valve terminal VTUG-8V-HOTSWAP (8123260)
  • Valve terminal VTUG-EX (8060699)
Information on substances in our products 19/09/2025 Substances in our products; Compliance

Festo SE & Co KG complies with national and international laws, guidelines, standards and regulations which are applicable to our products. We constantly monitor the dynamics of legislation. This Application Note give an overview.

2.90
02/07/2025
Certificate TUV-GE-B0132770527-00-DE 12/08/2025 General product safety

Associated products

  • #P-KOFFER D:S-P-A4-K (159319)
  • #T-BOX4 VERSCHR D:BOX4 VERSCHRAUBUNG (162339)
  • ABFRAGE PNEUM. D:ER-WSR-25/S3-PK3 (30306)
  • ABFRAGE, PNEUM. D:MP-B-SE-PN-SMA (34098)
  • Accessories D:AIRCS-ZUB (8023860)
  • Accessories D:MP2-UNMONT.M.VAKUUM (192249)
  • Accessories D:MP2-UNMONT.O.VAKUUM (192250)
  • Accessories D:MP2-UNMONT.STAT.PRUEF. (192251)
  • Accessories D:MP3-ACC-S-SO (8100162)
  • Accessories D:MP3-ACC-S-VE (8100161)
  • Accessories D:MP4-BG-M-SM-AS (8194953)
  • adaptive shape gripper kit for robots DHEF-20-A-RA1 (8119114)
  • adaptive shape gripper kit for robots DHEF-20-A-RA50 (8210811)
  • Adsorption dryer LDF-H1-G1/4-110 (178517)
  • Adsorption dryer LDF-H1-G1/4-230 (178518)
  • Adsorption dryer LDF-H1-G1/4-24 (178516)
  • Adsorption dryer LDF-H1-N1/4-110 (185675)
  • Adsorption dryer LDF-H1-N1/4-24 (185674)
  • Adsorption dryer LDF-H2-G1/4-110 (178520)
  • Adsorption dryer LDF-H2-G1/4-230 (178521)
  • Adsorption dryer LDF-H2-G1/4-24 (178519)
  • Adsorption dryer LDF-H2-N1/4-110 (185677)
  • Adsorption dryer LDF-H2-N1/4-24 (185676)
  • Adsorption dryer LDF-H3-G1/4-110 (178523)
  • Adsorption dryer LDF-H3-G1/4-230 (178524)
  • Adsorption dryer LDF-H3-N1/4-110 (185679)
  • Adsorption dryer LDF-H3-N1/4-24 (185678)
  • Adsorption dryer LDF-H4-G1/2 (178525)
  • Adsorption dryer LDF-H4-N1/2 (185680)
  • Adsorption dryer LDF-H5-G1/2 (178528)
  • Adsorption dryer LDF-H5-N1/2 (185682)
  • Adsorption dryer LDF-H6-G1/2 (178531)
  • Adsorption dryer LDF-H6-N1/2 (185684)
  • Adsorption dryer LDF-H7-G1/2 (178534)
  • Adsorption dryer LDF-H7-N1/2 (185686)
  • Assembly kit D:SKC-BG-TBD-CPS-WT-KIT (8187829)
  • Assembly kit D:SKC-BG-TBD-SC-WT-KIT (8187826)
  • assembly module RH_2400.07.075.0-B17.5.100.0 (8107013)
  • Assortment of spare parts D:PAL-MECH-12-ETS-7-11 (8023843)
  • BACK PRESSURE V D:ER-SDV-3 (13383)
  • Basic kit D:MPS-PA-WSI-EDS-WGMT-ZUBEHOER (8046117)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-ND9102FN-(FF) (4348548)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4348552)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-ND9102PN-(PP) (4348551)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-PS2 (4-20MA) (4406353)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-PS2 (FF) (4406351)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-PS2 (HART) (4406352)
  • Butterfly valve unit VZSA-100-W16E-PD-LFR-PS2 (PP) (4406495)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-ND9103FN-(FF) (4349181)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-ND9103HN-(4-20MA/HART) (4349180)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-ND9103PN-(PP) (4349183)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-PS2 (4-20MA) (4406573)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-PS2 (FF) (4406574)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-PS2 (HART) (4406571)
  • Butterfly valve unit VZSA-125-W16E-PD-LFR-PS2 (PP) (4406709)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-ND9103FN-(FF) (4349914)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-ND9103HN-(4-20MA/HART) (4349912)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-ND9103PN-(PP) (4349913)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-PS2 (4-20MA) (4406795)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-PS2 (FF) (4406796)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-PS2 (HART) (4406792)
  • Butterfly valve unit VZSA-150-W16E-PD-LFR-PS2 (PP) (4406900)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-ND9102FN-(FF) (4320763)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4320783)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-ND9102PN-(PP) (4320764)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-PS2 (4-20MA) (4404565)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-PS2 (FF) (4404566)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-PS2 (HART) (4404567)
  • Butterfly valve unit VZSA-40-W16E-PD-LFR-PS2 (PP) (4404575)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-ND9102FN-(FF) (4340721)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4340722)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-ND9102PN-(PP) (4340720)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-PS2 (4-20MA) (4404957)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-PS2 (FF) (4404956)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-PS2 (HART) (4404955)
  • Butterfly valve unit VZSA-50-W16E-PD-LFR-PS2 (PP) (4405203)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-ND9102FN-(FF) (4346532)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4346533)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-ND9102PN-(PP) (4346531)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-PS2 (4-20MA) (4405835)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-PS2 (FF) (4405831)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-PS2 (HART) (4405832)
  • Butterfly valve unit VZSA-65-W16E-PD-LFR-PS2 (PP) (4405841)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-ND9102FN-(FF) (4347175)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-ND9102HN-(4-20MA/HART) (4347174)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-ND9102PN-(PP) (4347173)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-PS2 (4-20MA) (4406094)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-PS2 (FF) (4406095)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-PS2 (HART) (4406096)
  • Butterfly valve unit VZSA-80-W16E-PD-LFR-PS2 (PP) (4406229)
  • Butterfly valve VZAV-C-100-10-CS (8122602)
  • Butterfly valve VZAV-C-40-16-CS (8122604)
  • Butterfly valve VZAV-C-50-16-CS (8122601)
  • Butterfly valve VZAV-C-80-10-CS (8122603)
  • Command memory module D:ER-SBA-2N-PK-3 (10899)
  • Compact cylinder KDPC-ADN-S (8155527)
  • Compact cylinder KDPC-AEN-S (8155528)
  • Compact cylinder KDSC-ADN (2926682)
  • Compressed air supply CADC-DE1-.. (8068847)
  • Compressed air supply CADC-DE2-.. (8068848)
  • Compressed air supply CADC-PPS-.. (8077430)
  • connecting cable NEBV-Z4WA2L-P-E-0.5-N-M8G3-S1 (8047673)
  • Consumables D:MPS-POOL-2015-ST-PP-MAG (8059688)
  • Control block 1409332 (543221)
  • Control block 1409333 (543335)
  • Control block 1409334 (543336)
  • Control block H6 809 022 00 00 (543338)
  • Control block HIQ-DIALOG-P-35-DM16-M/O-AG (8201890)
  • Control block HIQ-DIALOG-P-35-DM32-M/O-AG (8201828)
  • Control block HIQ-DIALOG-S-20M/O-AG (8201504)
  • Control block HIQ-S-20L/HIQ-DIA-S-35M/O-AG (8201557)
  • Control block HIQ-VARIO-P-35M-AG (8199960)
  • Control block HIQ-VARIO-S-20/30M-AG (8201403)
  • Control block HIQ-VARIO-S-35M-AG (8201024)
  • Control block KOMPLETT (152030)
  • Control cabinet 0679500-000 (8093369)
  • Control cabinet 0990.0035.000.06 (8171731)
  • Control cabinet 0990.LU00.000.68 (8114575)
  • Control cabinet 29L0321228E (8071326)
  • Control cabinet 29L0324932B (8071327)
  • Control cabinet 29L0325410E (8071320)
  • Control cabinet 29L0338219F (8071335)
  • Control cabinet 29L0338369D (8071331)
  • Control cabinet 29L0351847E (8077764)
  • Control cabinet 29L0351847E (8174723)
  • Control cabinet 29L0353121F (8077539)
  • Control cabinet 29L0353121F (8174600)
  • Control cabinet 29L0361564F (8071023)
  • Control cabinet 29L0361733E (8071300)
  • Control cabinet 29L0361736B (8071303)
  • Control cabinet 29L0361739H (8071311)
  • Control cabinet 29L0361753G (8071299)
  • Control cabinet 29L0361967B (8071312)
  • Control cabinet 29L0361968D (8070839)
  • Control cabinet 29L0396036H (8077422)
  • Control cabinet 29L0396036H (8174705)
  • Control cabinet 29L0396167F (8077672)
  • Control cabinet 29L0396167F (8174736)
  • Control cabinet 29L0396168H (8077484)
  • Control cabinet 29L0396168H (8174553)
  • Control cabinet 29L0396170B (8077794)
  • Control cabinet 29L0396170B (8174684)
  • Control cabinet 29L0475408D (8142998)
  • Control cabinet 29L0517244E (8145465)
  • Control cabinet 29L0560398E (8151824)
  • Control cabinet 29L0560399G (8152056)
  • Control cabinet 29L0560400L (8152121)
  • Control cabinet 29L0601742D (8145468)
  • Control cabinet 29L0621464H (8151624)
  • Control cabinet 4408159 (8136949)
  • Control cabinet 90459-3832 VENTING BOX (8046136)
  • Control cabinet CABINET AIR DISTRIBUTOR (8118003)
  • Control cabinet LFR+VUVS (8171722)
  • Control cabinet MEYN 0990.BR16.B00.06 (8201120)
  • Control cabinet MPAL+FR+QS (8113544)
  • Control cabinet P1E BOX (8152958)
  • Control cabinet PN-CPE14-MS4 (8171721)
  • Control cabinet PN-MPAL-SDE5-LFR (8151680)
  • Control cabinet PN-VUVS-MS4-MPYE-SFAB (8212381)
  • Control cabinet PROCESS CABINET 1XVZXA (8105567)
  • Control cabinet PROCESS CABINET 2XVZXA (8105568)
  • Control cabinet QUBE 16 CHANNEL (4101554)
  • Control cabinet RAPID PLUS M5 (8149820)
  • Control cabinet RAPID-PLUS-M5.0ETHER-CAT (8149818)
  • Control cabinet VTUG+VPPM (8114459)
  • Control cabinet VTUS PVC 7627375 (8161885)
  • Control cabinet VTUS PVC 7627376 (8161852)
  • Control cabinet VTUS PVC 7627377 (8161886)
  • Control cabinet VTUS PVC 7627378 (8161973)
  • Control cabinet VTUS20 - 4440897 (8100694)
  • Control cabinet VTUS20 - 4460724 (8100837)
  • Control cabinet VTUS20 - 4492564 (8100838)
  • Control cabinet VTUS20 - 7615348 (8100840)
  • Control panel 1028691 (8142070)
  • Control panel 1181934 (8192533)
  • Control panel 1990832 (8192134)
  • Control panel 1990834 (8192135)
  • Control panel 2832309-0005 (8128739)
  • Control panel 2838672-0300 (8064033)
  • Control panel 29L0360488D (8145464)
  • Control panel 29L0362298C (8077892)
  • Control panel 29L0374746H (8078513)
  • Control panel 3097362-0001_AD (8102173)
  • Control panel 3156059-0001_AD (8102597)
  • Control panel 3357976-0100_AC (8070626)
  • Control panel 3371181-1_AG (8235533)
  • Control panel 3409804-0002_AG (8107676)
  • Control panel 3447980-0001_AD (8117160)
  • Control panel 3447980-0002_AC (8117696)
  • Control panel 3447980-0003_AD (8117757)
  • Control panel 3447980-0004_AC (8117763)
  • Control panel 3453500-0001_AA (8107775)
  • Control panel 3468303-1_AD (8202876)
  • Control panel 3468303-6_AC (8202940)
  • Control panel 3496910-0101_AJ (8133522)
  • Control panel 3502315-0001_AA (8107757)
  • Control panel 3502782-0101 (8121350)
  • Control panel 3674436-0100 (8159274)
  • Control panel 3674436-0100_AA (8190340)
  • Control panel 5.178.7269.3.3_16 PROP VALVES (4700862)
  • Control panel 5.725.5047.3.2_12 PROP VALVES (4701280)
  • Control panel 765767 CONTROL UNIT (4164801)
  • Control panel 768519 (8143240)
  • Control panel 768520 (8142160)
  • Control panel 851115676-DUPLEX-CS (8189069)
  • Control panel 851115680-TRIPLEX-CS (8189071)
  • Control panel 85112401-SIMPLEX-CS (8189070)
  • Control panel A6Z540 (8125867)
  • Control panel AUFLAGEKONTROLLE (8226496)
  • Control panel BELIMED 765771 (4145952)
  • Control panel BK01-BASIC-SLOW (8085264)
  • Control panel BK03-COMFORT-SLOW (8092489)
  • Control panel BK04-COMFORT-SPEED (8092490)
  • Control panel BK05-COM.-SLOW-DP-EXT (8092535)
  • Control panel BK06-COM.-SPEED-DP-EXT (8092538)
  • Control panel BK-OPTION-140.7 (8092826)
  • Control panel BK-OPTION-179.7 (8092825)
  • Control panel BK-OPTION-180.7 (8092827)
  • Control panel DAGE BOND PANEL TESTER (8168366)
  • Control panel F3.336.051F/01 (5188622)
  • Control panel F4.336.051F/03 (8064028)
  • Control panel F4.336.051F/05 (8224332)
  • Control panel FESTO CS1392880 (4795068)
  • Control panel FESTO CS1485105 (8081322)
  • Control panel FESTO CS1502793 (4929011)
  • Control panel FESTO CS1529414 (5270145)
  • Control panel FESTO CS1529425 (5270273)
  • Control panel FESTO CS1532519 (5326289)
  • Control panel FESTO CS1532521 (5340797)
  • Control panel FESTO CS1532525 (5333498)
  • Control panel FESTO CS1559043 (8081186)
  • Control panel FESTO CS1593154 (8116727)
  • Control panel FESTO CS1608608 (8118119)
  • Control panel FESTO CS1633038 (8129492)
  • Control panel HELITRONIC MICRO W/O OPTION (8166602)
  • Control panel I.7-DAUE+SL (8156287)
  • Control panel I.7-MED-DOC (8156288)
  • Control panel MEDIENDOCKING IW6 (8090746)
  • Control panel MPA P60-2/P90-1 (8178779)
  • Control panel MPA-FB-VI (8083674)
  • Control panel MPL-2X-ISO3-MS6-DL (5326785)
  • Control panel PANEL ASEPTIC FLAT (8156794)
  • Control panel PNEUMATIC-MANIFOLD (5059609)
  • Control panel PN-VZWF-MS (8128898)
  • Control panel RIETER 11134036 (8114998)
  • Control panel RIP SERVO ROBOT (8094893)
  • Control panel SIDEL CODE 04313458302 (4759605)
  • Control panel SIDEL CODE 04315605701 (4777827)
  • controller GMS,G5,IC2,P2 100249365 (8194516)
  • Cylinder assembly MAGAZINKLAPPE RECHTS (575466)
  • Cylinder combination CYLINDER-VALVE ASSEMBLY (577356)
  • Cylinder E-16-23.5-P-CS (8059508)
  • Cylinder ZVK-DNC-100+CPE24 (1554623)
  • Cylinder/valve combination ADN-32+VUVG-L14+NEBU-M8W3+QS (8119269)
  • Cylinder/valve combination DSBC+VUVS (8128371)
  • Cylinder/valve combination DSBC-40-150-JMFH-CS (8161898)
  • Cylinder/valve combination DSBC-40-200-MFH-CS (8161892)
  • Cylinder/valve combination DSBC-50-150-JMFH-CS (8161894)
  • Cylinder/valve combination DSBC-50-250-MFH-CS (8161893)
  • Cylinder/valve combination DSBC-50-300-MFH-CS (8161895)
  • Cylinder/valve combination DSBC-50-350-MFH-CS (8161896)
  • Cylinder/valve combination DSBC-63-150-JMFH-CS (8161897)
  • Cylinder/valve combination DSBC-L-80-200+LR (8075889)
  • Cylinder/valve combination E/MHA1-16-20-P-CS (4408281)
  • DEMO CASE D:T2S-EGS-DEMO-SYST (8048283)
  • Didactic Training Appliance D:L SENSOR IO-LINK FLOW (8115026)
  • Didactic Training Appliance D:L SENSOR IO-LINK PRESSURE (8115027)
  • DUO spiral plastic tubing PUN-10X1,5-S-1-DUO-BS (197626)
  • DUO spiral plastic tubing PUN-10X1,5-S-2-DUO-BS (197627)
  • DUO spiral plastic tubing PUN-10X1,5-S-6-DUO-BS (197628)
  • DUO spiral plastic tubing PUN-12X2-S-1-DUO-BS (197629)
  • DUO spiral plastic tubing PUN-12X2-S-2-DUO-BS (197630)
  • DUO spiral plastic tubing PUN-12X2-S-6-DUO-BS (197631)
  • DUO spiral plastic tubing PUN-4X0,75-S-0,5-DUO-BS (197617)
  • DUO spiral plastic tubing PUN-4X0,75-S-1,5-DUO-BS (197619)
  • DUO spiral plastic tubing PUN-4X0,75-S-1-DUO-BS (197618)
  • DUO spiral plastic tubing PUN-6X1-S-1-DUO-BS (197620)
  • DUO spiral plastic tubing PUN-6X1-S-2-DUO-BS (197621)
  • DUO spiral plastic tubing PUN-6X1-S-6-DUO-BS (197622)
  • DUO spiral plastic tubing PUN-8X1,25-S-1-DUO-BS (197623)
  • DUO spiral plastic tubing PUN-8X1,25-S-2-DUO-BS (197624)
  • DUO spiral plastic tubing PUN-8X1,25-S-6-DUO-BS (197625)
  • DUO tubing PUN-10X1,5-DUO-BS (159677)
  • DUO tubing PUN-10X1,5-DUO-SI (152825)
  • DUO tubing PUN-4X0,75-DUO-BS (159674)
  • DUO tubing PUN-4X0,75-DUO-SI (152822)
  • DUO tubing PUN-6X1-DUO-BS (159675)
  • DUO tubing PUN-6X1-DUO-SI (152823)
  • DUO tubing PUN-8X1,25-DUO-BS (159676)
  • DUO tubing PUN-8X1,25-DUO-SI (152824)
  • DUO tubing PUN-H-10X1,5-DUO (197399)
  • DUO tubing PUN-H-4X0,75-DUO (197396)
  • DUO tubing PUN-H-6X1-DUO (197397)
  • DUO tubing PUN-H-6X1-DUO-BS-200 (553969)
  • DUO tubing PUN-H-8X1,25-DUO (197398)
  • Edutrainer D:AIRCS-GS (8023859)
  • Edutrainer D:ET-BG-MESGT-ENERGIE-1P (8129208)
  • Edutrainer D:ET-BG-MESGT-ENERGIE-3P (8130678)
  • Emergency-stop pushbutton D:S-PSV-3/2-SO+NAT (152864)
  • energy efficiency module D:MP4-BG-ENERGY-KIT (8154889)
  • EP-KOFFER D:S-EP-A4-K (159320)
  • Equipment set D:BIO-BS-KPL (574151)
  • Equipment set D:BIO-BS-KPL-BW (8033635)
  • Equipment set D:WSI-POLYMECH-BG (8046236)
  • Experimentation plate D:FU-LB-K01 (167201)
  • Experimentation plate D:FU-LB-K01-EASY (539740)
  • FIELDKIT-IBS D:FIELDKIT-1131 -D (159296)
  • filter regulator CADC-ZFR-.. (8068851)
  • Flat cylinder KDPF-DZF (8217048)
  • Flat cylinder KDPF-DZH (8217047)
  • Front unit ERMH-11 (1234366)
  • Front unit ERMH-11-P (1234378)
  • Front unit ERMH-11-P-E17-100 (3383156)
  • Front unit ERMH-11-P-E17-30 (3385154)
  • Front unit ERMH-8 (1234379)
  • Front unit ERMH-8-P (1557788)
  • Front unit ERMH-8-P-E17-15 (3383151)
  • Front unit ERMH-8-P-E17-30 (3385152)
  • Gate valve unit VZSK-100-PW-V-10 (8091070)
  • Gripper D:MP3-M-RO-GR-PNEU (573859)
  • Gripper D:MP4-BG-PP-GR (8064882)
  • Guided drive KDGR-DFM (8046537)
  • Handling module DGCI-25-1000 MIT WINKEL (4444542)
  • Handling module DGCI-25-1250 MIT WINKEL (4443985)
  • Handling module DGCI-25-1250-KF-QR-GP-CS (8122550)
  • Handling module DGCI-25-1500 MIT WINKEL (4343243)
  • Handling module DGCI-25-1500-KF-QR-GP-CS (8104372)
  • Handling module DGCI-25-1500-KF-QR-GP-CS (8207287)
  • Handling module DHMZ-DGSL-16- - (8004634)
  • Handling module DHMZ-DGSL-20- - (8004635)
  • Handling module DVP-860 (4187407)
  • Handling module DVP-960 (4183830)
  • Handling system 810_STD_2 (8108180)
  • heavy-duty tubing PAN-R-10X1,9-SI (541677)
  • heavy-duty tubing PAN-R-12X2,2-SI (541678)
  • heavy-duty tubing PAN-R-16X3-SI (541679)
  • heavy-duty tubing PAN-R-4X0,75-SI (541674)
  • heavy-duty tubing PAN-R-6X1,1-SI (541675)
  • heavy-duty tubing PAN-R-8X1,5-SI (541676)
  • HUBEINHEIT D:S-PAZ-ADVU/VAL (174857)
  • Hydraulic power unit D:AS-H-A2 (30303)
  • Installation kit JLR_HIP-2-AIR (8061524)
  • Installation kit JLR_HIP-2-AIR/WATER (8061525)
  • Installation kit JLR_RIP-MS6-ZONE STANDS AL (8061527)
  • Installation kit JLR_RIP-MS9-ZONE STANDS AL (8061526)
  • Installation kit RIP-TYPE 3 (8132617)
  • Installation kit RSU-TYPE 3 (8154431)
  • INTEGRATIONSBL. VARIANTE 200 (35093)
  • Limit switch-attachment QH-DR-E-S3-PK-3-B-B (164855)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(FF)-V (5384630)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(FF)-VR (5384772)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(HART)-V (5365502)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(HART)-VR (5367112)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(PA)-V (5384462)
  • Linear drive unit DFPI-100-250-E-NB3P-LFR-PS2(PA)-VR (5384773)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(FF)-V (5390206)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(FF)-VR (5390210)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(HART)-V (5389651)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(HART)-VR (5390209)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(PA)-V (5390208)
  • Linear drive unit DFPI-125-250-E-NB3P-LFR-PS2(PA)-VR (5390207)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(FF)-F (5400983)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(FF)-V (8070075)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(FF)-VR (8070078)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(HART)-F (5400984)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(HART)-V (5402103)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(HART)-VR (8070079)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(PA)-F (5400980)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(PA)-V (8070076)
  • Linear drive unit DFPI-160-250-E-NB3P-BO-LFR-PS2(PA)-VR (8070077)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(FF)-F (5400762)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(FF)-V (8072787)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(FF)-VR (8072793)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(HART)-F (5397025)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(HART)-V (8072789)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(HART)-VR (8072792)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(PA)-F (5400729)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(PA)-V (8072790)
  • Linear drive unit DFPI-200-250-E-NB3P-BO-LFR-PS2(PA)-VR (8072791)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(FF)-F (8073111)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(FF)-V (8073127)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(FF)-VR (8073125)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(HART)-F (8073109)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(HART)-V (8073124)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(HART)-VR (8073129)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(PA)-F (8073110)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(PA)-V (8073128)
  • Linear drive unit DFPI-250-300-E-NB3P-BO-LFR-PS2(PA)-VR (8073126)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(FF)-F (8076782)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(FF)-V (8076856)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(FF)-VR (8076859)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(HART)-F (8076784)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(HART)-V (8076785)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(HART)-VR (8076858)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(PA)-F (8076783)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(PA)-V (8076855)
  • Linear drive unit DFPI-320-350-E-NB3P-BO-LFR-PS2(PA)-VR (8076857)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-ND9106(FF) (4480474)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-ND9106(HART) (4480477)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-ND9106(PP) (4480478)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-PS(4-20MA) (4597711)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-PS(FF) (4597712)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-PS(HART) (4597621)
  • Linear drive unit DFPI-320-545-ND2P-E-NB3P-BO-LFR-SGS-FNG-PS(PP) (4597713)
  • Linear drive unit DSBG-125-200-PA-N3-FK-MPA-ND7103HNRREC (8115548)
  • Linear drive unit DSBG-200-350-PA-N3-FK-MPA-ND7106HNRREC (8115703)
  • Linear drive unit DSBG-320-500-PA-N3-SGS-MPA-ND7106HNRREC (8116320)
  • Linear drive DFPI-100- -ND2P-C1V (558189)
  • Linear drive DFPI-100- -ND2P-C1V-A (1548004)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-A (2184841)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-A-EX-CS (8128873)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-A-HA-EX-CS (8200156)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-R-A (4588304)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-R-A-EX-CS (8128880)
  • Linear drive DFPI-100- -ND2P-C1V-NB3P-R-A-HA-EX-CS (8200337)
  • Linear drive DFPI-100- -ND2P-C1V-P (561380)
  • Linear drive DFPI-100- -ND2P-C1V-P-A (1548005)
  • Linear drive DFPI-125- -ND2P-C1V (558190)
  • Linear drive DFPI-125- -ND2P-C1V-A (1548020)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-A (2180905)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-A-EX-CS (8128878)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-A-HA-EX-CS (8200157)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-R-A (4588636)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-R-A-EX-CS (8128879)
  • Linear drive DFPI-125- -ND2P-C1V-NB3P-R-A-HA-EX-CS (8200336)
  • Linear drive DFPI-125- -ND2P-C1V-P (561381)
  • Linear drive DFPI-125- -ND2P-C1V-P-A (1548021)
  • Linear drive DFPI-160- -ND2P-C1V (558191)
  • Linear drive DFPI-160- -ND2P-C1V-A (1548026)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-A (2201101)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-A-EX-CS (8128894)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-A-HA-EX-CS (8200158)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-R-A (4588972)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-R-A-EX-CS (8128895)
  • Linear drive DFPI-160- -ND2P-C1V-NB3P-R-A-HA-EX-CS (8200338)
  • Linear drive DFPI-160- -ND2P-C1V-P (561382)
  • Linear drive DFPI-160- -ND2P-C1V-P-A (1548028)
  • Linear drive DFPI-160-100-ND2P-C1V (3489129)
  • Linear drive DFPI-200- -ND2P-C1V (563789)
  • Linear drive DFPI-200- -ND2P-C1V-A (1548030)
  • Linear drive DFPI-200- -ND2P-C1V-NB3P-A (2206373)
  • Linear drive DFPI-200- -ND2P-C1V-NB3P-A-EX-CS (8128901)
  • Linear drive DFPI-200- -ND2P-C1V-NB3P-R-A (4587974)
  • Linear drive DFPI-200- -ND2P-C1V-NB3P-R-A-EX-CS (8128900)
  • Linear drive DFPI-200- -ND2P-C1V-P (563792)
  • Linear drive DFPI-200- -ND2P-C1V-P-A (1548032)
  • Linear drive DFPI-250- -ND2P-C1V (563790)
  • Linear drive DFPI-250- -ND2P-C1V-A (1548037)
  • Linear drive DFPI-250- -ND2P-C1V-NB3P-A (2200311)
  • Linear drive DFPI-250- -ND2P-C1V-NB3P-A-EX-CS (8128914)
  • Linear drive DFPI-250- -ND2P-C1V-NB3P-R-A (4591209)
  • Linear drive DFPI-250- -ND2P-C1V-NB3P-R-A-EX-CS (8128915)
  • Linear drive DFPI-250- -ND2P-C1V-P (563793)
  • Linear drive DFPI-250- -ND2P-C1V-P-A (1548039)
  • Linear drive DFPI-320- -ND2P-C1V (563791)
  • Linear drive DFPI-320- -ND2P-C1V-A (1548041)
  • Linear drive DFPI-320- -ND2P-C1V-NB3P-A (2185309)
  • Linear drive DFPI-320- -ND2P-C1V-NB3P-A-EX-CS (8128932)
  • Linear drive DFPI-320- -ND2P-C1V-NB3P-R-A (4591205)
  • Linear drive DFPI-320- -ND2P-C1V-NB3P-R-A-EX-CS (8128931)
  • Linear drive DFPI-320- -ND2P-C1V-P (563794)
  • Linear drive DFPI-320- -ND2P-C1V-P-A (1548044)
  • Linear drive DFPI-480-450-E-P-G2-CS (8103778)
  • Linear drive KDFP-DFPI (8066876)
  • Linear gantry EXCT-100- - (8026577)
  • Linear gantry EXCT-15- - (8026575)
  • Linear gantry EXCT-30- - (8026576)
  • Master unit D:FU-MU (167196)
  • Micro reflex sensor D:S-PSR-RML-5 (152869)
  • Mini slide DGSL-16-100-Y3A (544003)
  • Mini slide DGSL-16-10-PA (543983)
  • Mini slide DGSL-16-150-Y3A (544004)
  • Mini slide DGSL-16-20-PA (543984)
  • Mini slide DGSL-16-30-PA (543985)
  • Mini slide DGSL-16-40-PA (543986)
  • Mini slide DGSL-16-50-PA (543987)
  • Mini slide DGSL-16-50-Y3A (544001)
  • Mini slide DGSL-16-80-Y3A (544002)
  • Mini slide DGSL-20-100-Y3A (544027)
  • Mini slide DGSL-20-10-PA (544005)
  • Mini slide DGSL-20-150-Y3A (544028)
  • Mini slide DGSL-20-200-Y3A (544029)
  • Mini slide DGSL-20-20-PA (544006)
  • Mini slide DGSL-20-30-PA (544007)
  • Mini slide DGSL-20-40-PA (544008)
  • Mini slide DGSL-20-50-PA (544009)
  • Mini slide DGSL-20-50-Y3A (544025)
  • Mini slide DGSL-20-80-Y3A (544026)
  • Mini slide KDGS-DGST (8145469)
  • Model D:S-KFZ-BREMS-BV (195444)
  • Model D:S-KFZ-NIVEAU-NR (195445)
  • Model D:S-KFZ-SICHER-SV (195443)
  • Module D:MP2-M-US-PN (167253)
  • Module D:MP2-M-VZ-PN (167254)
  • Mounting plate 20368198 (8150664)
  • Mounting plate 20384615 (8150672)
  • Mounting plate 20384750 (8150673)
  • Mounting plate 20385142 (8150670)
  • Mounting plate 20415561 (8150671)
  • Mounting plate 2846102-0200 (8046570)
  • Mounting plate 2878267-0200 A3/CF (8049039)
  • Mounting plate 2986743-0200 (8049040)
  • Mounting plate 3108445-0002_TK/OR/PPF/Z/1/000 (4060393)
  • Mounting plate 3406543-1 (8058539)
  • Mounting plate 3406546-0101 FLAP HEATER (8058376)
  • Mounting plate DISTRIBUTION PANEL (4075445)
  • Mounting plate LVD G7930504H (3521824)
  • Mounting plate QPATCH 24 CHANNEL (4238083)
  • Mounting plate QPATCH 56 CHANNEL (4341500)
  • MPS+ BEARBEITEN D:MP-S-B+-NPN (162368)
  • MPS+ HANDH. HHG D:MP-S-H-HHG+ (121224)
  • MPS+ HANDH. HHG D:MP-S-H-HHG+-NPN (162369)
  • MPS+ PROCESSING D:MP-S-B+ (121222)
  • MPS+ PRUEFEN D:MP-S-P+ (121220)
  • MPS+ PRUEFEN D:MP-S-P+-NPN (162370)
  • MPS+ PUFFERSTR. D:MP-S-PS+ (121221)
  • MPS+ PUFFERSTR. D:MP-S-PS+-NPN (162371)
  • MPS+ SORTIEREN D:MP-S-S+ (121223)
  • MPS+ SORTIEREN D:MP-S-S+-NPN (162372)
  • MPS+ VERTEILEN D:MP-S-V+ (121218)
  • MPS+ VERTEILEN D:MP-S-V+-NPN (162373)
  • On/off valve D:S-PSV-3/2-S-3+S (152863)
  • On/off valve D:S-PSV-3/2-S-3+T (152860)
  • On/off valve D:S-PSV-3/2-S-3+T-FC (4978036)
  • On/off valve D:S-PSV-3/2-SO-3+T (152861)
  • On/off valve D:S-PSV-5/2-S+SO+S (152862)
  • On/off valve MS6-EM1-AGD-R-S-A4-WPB-EX4-CS (8092816)
  • Parallel gripper HGPPI-12-10-PB (539054)
  • Parallel kinematic (system) EXPT-120-E4 (569800)
  • Parallel kinematic (system) EXPT-45-E1 (569797)
  • Parallel kinematic (system) EXPT-70-E1 (569798)
  • Parallel kinematic (system) EXPT-95-E4 (569799)
  • Planar surface gantry EXCH-40- (1923050)
  • Planar surface gantry EXCH-60- (1939785)
  • Planar surface gantry EXCM-40- (3741955)
  • Planar surface gantry LONG GRAIN 6X6FT (8107553)
  • Planar surface gantry LONG GRAIN 8X6FT (8107563)
  • Planar surface gantry LONG GRAIN 8X8FT (8107568)
  • Plastic tubing PAN (553610)
  • Plastic tubing PAN-10X1,5-BL (553909)
  • Plastic tubing PAN-10X1,5-BL-300 (553897)
  • Plastic tubing PAN-10X1,5-GE (553933)
  • Plastic tubing PAN-10X1,5-GN (553921)
  • Plastic tubing PAN-10X1,5-NT (546287)
  • Plastic tubing PAN-10X1,5-RT (553927)
  • Plastic tubing PAN-10X1,5-SI (152701)
  • Plastic tubing PAN-10X1,5-SI-300 (553891)
  • Plastic tubing PAN-10X1,5-SW (553915)
  • Plastic tubing PAN-10X1,5-SW-300 (553903)
  • Plastic tubing PAN-12X1,75-BL (553910)
  • Plastic tubing PAN-12X1,75-BL-200 (553898)
  • Plastic tubing PAN-12X1,75-GE (553934)
  • Plastic tubing PAN-12X1,75-GN (553922)
  • Plastic tubing PAN-12X1,75-NT (546288)
  • Plastic tubing PAN-12X1,75-RT (553928)
  • Plastic tubing PAN-12X1,75-SI (152702)
  • Plastic tubing PAN-12X1,75-SI-200 (553892)
  • Plastic tubing PAN-12X1,75-SW (553916)
  • Plastic tubing PAN-12X1,75-SW-200 (553904)
  • Plastic tubing PAN-14X2-SI (570392)
  • Plastic tubing PAN-16X2-BL (553911)
  • Plastic tubing PAN-16X2-BL-100 (553899)
  • Plastic tubing PAN-16X2-GE (553935)
  • Plastic tubing PAN-16X2-GN (553923)
  • Plastic tubing PAN-16X2-NT (546289)
  • Plastic tubing PAN-16X2-RT (553929)
  • Plastic tubing PAN-16X2-SI (152703)
  • Plastic tubing PAN-16X2-SI-100 (553893)
  • Plastic tubing PAN-16X2-SW (553917)
  • Plastic tubing PAN-16X2-SW-100 (553905)
  • Plastic tubing PAN-4X0,75-BL (553906)
  • Plastic tubing PAN-4X0,75-BL-500 (553894)
  • Plastic tubing PAN-4X0,75-GE (553930)
  • Plastic tubing PAN-4X0,75-GN (553918)
  • Plastic tubing PAN-4X0,75-NT (546284)
  • Plastic tubing PAN-4X0,75-RT (553924)
  • Plastic tubing PAN-4X0,75-SI (152697)
  • Plastic tubing PAN-4X0,75-SI-500 (553888)
  • Plastic tubing PAN-4X0,75-SW (553912)
  • Plastic tubing PAN-4X0,75-SW-500 (553900)
  • Plastic tubing PAN-6X1-BL (553907)
  • Plastic tubing PAN-6X1-BL-500 (553895)
  • Plastic tubing PAN-6X1-GE (553931)
  • Plastic tubing PAN-6X1-GN (553919)
  • Plastic tubing PAN-6X1-NT (546285)
  • Plastic tubing PAN-6X1-RT (553925)
  • Plastic tubing PAN-6X1-SI (152699)
  • Plastic tubing PAN-6X1-SI-500 (553889)
  • Plastic tubing PAN-6X1-SW (553913)
  • Plastic tubing PAN-6X1-SW-500 (553901)
  • Plastic tubing PAN-8X1,25-BL (553908)
  • Plastic tubing PAN-8X1,25-BL-400 (553896)
  • Plastic tubing PAN-8X1,25-GE (553932)
  • Plastic tubing PAN-8X1,25-GN (553920)
  • Plastic tubing PAN-8X1,25-NT (546286)
  • Plastic tubing PAN-8X1,25-RT (553926)
  • Plastic tubing PAN-8X1,25-SI (152700)
  • Plastic tubing PAN-8X1,25-SI-400 (553890)
  • Plastic tubing PAN-8X1,25-SW (553914)
  • Plastic tubing PAN-8X1,25-SW-400 (553902)
  • Plastic tubing PAN-MF-6-NT-500-HA (8233314)
  • Plastic tubing PEN (553769)
  • Plastic tubing PEN-10X1,5-BL (551459)
  • Plastic tubing PEN-10X1,5-BL-300 (551447)
  • Plastic tubing PEN-10X1,5-GE (551483)
  • Plastic tubing PEN-10X1,5-GN (551471)
  • Plastic tubing PEN-10X1,5-NT (543249)
  • Plastic tubing PEN-10X1,5-NT-25 (556137)
  • Plastic tubing PEN-10X1,5-RT (551477)
  • Plastic tubing PEN-10X1,5-SI (551465)
  • Plastic tubing PEN-10X1,5-SI-300 (551453)
  • Plastic tubing PEN-10X1,5-SW (543243)
  • Plastic tubing PEN-10X1,5-SW-300 (551441)
  • Plastic tubing PEN-12X1,75-BL (551460)
  • Plastic tubing PEN-12X1,75-BL-200 (551448)
  • Plastic tubing PEN-12X1,75-GE (551484)
  • Plastic tubing PEN-12X1,75-GN (551472)
  • Plastic tubing PEN-12X1,75-NT (543250)
  • Plastic tubing PEN-12X1,75-NT-25 (556138)
  • Plastic tubing PEN-12X1,75-RT (551478)
  • Plastic tubing PEN-12X1,75-SI (551466)
  • Plastic tubing PEN-12X1,75-SI-200 (551454)
  • Plastic tubing PEN-12X1,75-SW (543244)
  • Plastic tubing PEN-12X1,75-SW-200 (551442)
  • Plastic tubing PEN-14X2-NT (570517)
  • Plastic tubing PEN-14X2-SW (570516)
  • Plastic tubing PEN-16X2,5-BL (551461)
  • Plastic tubing PEN-16X2,5-BL-100 (551449)
  • Plastic tubing PEN-16X2,5-GE (551485)
  • Plastic tubing PEN-16X2,5-GN (551473)
  • Plastic tubing PEN-16X2,5-NT (543251)
  • Plastic tubing PEN-16X2,5-RT (551479)
  • Plastic tubing PEN-16X2,5-SI (551467)
  • Plastic tubing PEN-16X2,5-SI-100 (551455)
  • Plastic tubing PEN-16X2,5-SW (543245)
  • Plastic tubing PEN-16X2,5-SW-100 (551443)
  • Plastic tubing PEN-4X0,75-BL (551456)
  • Plastic tubing PEN-4X0,75-BL-500 (551444)
  • Plastic tubing PEN-4X0,75-GE (551480)
  • Plastic tubing PEN-4X0,75-GN (551468)
  • Plastic tubing PEN-4X0,75-NT (543246)
  • Plastic tubing PEN-4X0,75-RT (551474)
  • Plastic tubing PEN-4X0,75-SI (551462)
  • Plastic tubing PEN-4X0,75-SI-500 (551450)
  • Plastic tubing PEN-4X0,75-SW (543240)
  • Plastic tubing PEN-4X0,75-SW-500 (551438)
  • Plastic tubing PEN-6X1-BL (551457)
  • Plastic tubing PEN-6X1-BL-500 (551445)
  • Plastic tubing PEN-6X1-GE (551481)
  • Plastic tubing PEN-6X1-GN (551469)
  • Plastic tubing PEN-6X1-NT (543247)
  • Plastic tubing PEN-6X1-NT-25 (556136)
  • Plastic tubing PEN-6X1-RT (551475)
  • Plastic tubing PEN-6X1-SI (551463)
  • Plastic tubing PEN-6X1-SI-500 (551451)
  • Plastic tubing PEN-6X1-SW (543241)
  • Plastic tubing PEN-6X1-SW-500 (551439)
  • Plastic tubing PEN-8-NT-TXT-50-CB (8211194)
  • Plastic tubing PEN-8X1,25-BL (551458)
  • Plastic tubing PEN-8X1,25-BL-400 (551446)
  • Plastic tubing PEN-8X1,25-GE (551482)
  • Plastic tubing PEN-8X1,25-GN (551470)
  • Plastic tubing PEN-8X1,25-NT (543248)
  • Plastic tubing PEN-8X1,25-NT-25 (553968)
  • Plastic tubing PEN-8X1,25-RT (551476)
  • Plastic tubing PEN-8X1,25-SI (551464)
  • Plastic tubing PEN-8X1,25-SI-400 (551452)
  • Plastic tubing PEN-8X1,25-SW (543242)
  • Plastic tubing PEN-8X1,25-SW-400 (551440)
  • Plastic tubing PLN (553850)
  • Plastic tubing PLN-10X1,5-BL (558208)
  • Plastic tubing PLN-10X1,5-NT (193406)
  • Plastic tubing PLN-10X1,5-RT (558220)
  • Plastic tubing PLN-10X1,5-SI (558214)
  • Plastic tubing PLN-10X1,5-SW (195283)
  • Plastic tubing PLN-12X1,75-BL (558209)
  • Plastic tubing PLN-12X1,75-NT (193407)
  • Plastic tubing PLN-12X1,75-RT (558221)
  • Plastic tubing PLN-12X1,75-SI (558215)
  • Plastic tubing PLN-12X1,75-SW (195284)
  • Plastic tubing PLN-14X2-NT (570424)
  • Plastic tubing PLN-14X2-SW (570423)
  • Plastic tubing PLN-16X2-BL (558210)
  • Plastic tubing PLN-16X2-NT (539064)
  • Plastic tubing PLN-16X2-RT (558222)
  • Plastic tubing PLN-16X2-SI (558216)
  • Plastic tubing PLN-16X2-SW (539065)
  • Plastic tubing PLN-4X0,75-BL (558205)
  • Plastic tubing PLN-4X0,75-NT (193403)
  • Plastic tubing PLN-4X0,75-RT (558217)
  • Plastic tubing PLN-4X0,75-SI (558211)
  • Plastic tubing PLN-4X0,75-SW (195280)
  • Plastic tubing PLN-6X1-BL (558206)
  • Plastic tubing PLN-6X1-NT (193404)
  • Plastic tubing PLN-6X1-RT (558218)
  • Plastic tubing PLN-6X1-SI (558212)
  • Plastic tubing PLN-6X1-SW (195281)
  • Plastic tubing PLN-8X1,25-BL (558207)
  • Plastic tubing PLN-8X1,25-NT (193405)
  • Plastic tubing PLN-8X1,25-RT (558219)
  • Plastic tubing PLN-8X1,25-SI (558213)
  • Plastic tubing PLN-8X1,25-SW (195282)
  • Plastic tubing PUN (553573)
  • Plastic tubing PUN-10X1,5-BL (159668)
  • Plastic tubing PUN-10X1,5-BL-300 (525749)
  • Plastic tubing PUN-10X1,5-GE (178420)
  • Plastic tubing PUN-10X1,5-GN (178427)
  • Plastic tubing PUN-10X1,5-RT (178413)
  • Plastic tubing PUN-10X1,5-SI (152588)
  • Plastic tubing PUN-10X1,5-SI-300 (525742)
  • Plastic tubing PUN-10X1,5-SW (159669)
  • Plastic tubing PUN-10X1,5-SW-300 (553940)
  • Plastic tubing PUN-12-BR-100-HA (8150420)
  • Plastic tubing PUN-12X2-BL (159670)
  • Plastic tubing PUN-12X2-BL-200 (525750)
  • Plastic tubing PUN-12X2-GE (178421)
  • Plastic tubing PUN-12X2-GN (178428)
  • Plastic tubing PUN-12X2-RT (178414)
  • Plastic tubing PUN-12X2-SI (152589)
  • Plastic tubing PUN-12X2-SI-200 (525743)
  • Plastic tubing PUN-12X2-SW (159671)
  • Plastic tubing PUN-12X2-SW-200 (553941)
  • Plastic tubing PUN-14-BL-100-HA (8221480)
  • Plastic tubing PUN-14-GN-100-HA (8208355)
  • Plastic tubing PUN-14-GN-50-CB (8150421)
  • Plastic tubing PUN-14-SW-100-HA (8221481)
  • Plastic tubing PUN-14X2-BL (570390)
  • Plastic tubing PUN-14X2-SI (570389)
  • Plastic tubing PUN-14X2-SW (570391)
  • Plastic tubing PUN-16X2,5-BL (159672)
  • Plastic tubing PUN-16X2,5-BL-100 (525751)
  • Plastic tubing PUN-16X2,5-GE (178422)
  • Plastic tubing PUN-16X2,5-GN (178429)
  • Plastic tubing PUN-16X2,5-RT (178415)
  • Plastic tubing PUN-16X2,5-SI (152590)
  • Plastic tubing PUN-16X2,5-SI-100 (525744)
  • Plastic tubing PUN-16X2,5-SW (159673)
  • Plastic tubing PUN-16X2,5-SW-100 (553942)
  • Plastic tubing PUN-3X0,5-BL (159660)
  • Plastic tubing PUN-3X0,5-BL-500 (525745)
  • Plastic tubing PUN-3X0,5-GE (178416)
  • Plastic tubing PUN-3X0,5-GN (178423)
  • Plastic tubing PUN-3X0,5-RT (178409)
  • Plastic tubing PUN-3X0,5-SI (152583)
  • Plastic tubing PUN-3X0,5-SI-500 (525738)
  • Plastic tubing PUN-3X0,5-SW (159661)
  • Plastic tubing PUN-3X0,5-SW-500 (553936)
  • Plastic tubing PUN-4X0,75-BL (159662)
  • Plastic tubing PUN-4X0,75-BL-500 (525746)
  • Plastic tubing PUN-4X0,75-GE (178417)
  • Plastic tubing PUN-4X0,75-GN (178424)
  • Plastic tubing PUN-4X0,75-RT (178410)
  • Plastic tubing PUN-4X0,75-SI (152584)
  • Plastic tubing PUN-4X0,75-SI-500 (525739)
  • Plastic tubing PUN-4X0,75-SW (159663)
  • Plastic tubing PUN-4X0,75-SW-500 (553937)
  • Plastic tubing PUN-6X1-BL (159664)
  • Plastic tubing PUN-6X1-BL-500 (525747)
  • Plastic tubing PUN-6X1-GE (178418)
  • Plastic tubing PUN-6X1-GN (178425)
  • Plastic tubing PUN-6X1-RT (178411)
  • Plastic tubing PUN-6X1-SI (152586)
  • Plastic tubing PUN-6X1-SI-500 (525740)
  • Plastic tubing PUN-6X1-SW (159665)
  • Plastic tubing PUN-6X1-SW-500 (553938)
  • Plastic tubing PUN-8X1,25-BL (159666)
  • Plastic tubing PUN-8X1,25-BL-400 (525748)
  • Plastic tubing PUN-8X1,25-GE (178419)
  • Plastic tubing PUN-8X1,25-GN (178426)
  • Plastic tubing PUN-8X1,25-RT (178412)
  • Plastic tubing PUN-8X1,25-SI (152587)
  • Plastic tubing PUN-8X1,25-SI-400 (525741)
  • Plastic tubing PUN-8X1,25-SW (159667)
  • Plastic tubing PUN-8X1,25-SW-400 (553939)
  • Plastic tubing PUN-H-10X1,5-BL (197386)
  • Plastic tubing PUN-H-10X1,5-BL-100-CS (8226422)
  • Plastic tubing PUN-H-10X1,5-BL-25 (8204441)
  • Plastic tubing PUN-H-10X1,5-BL-300 (558260)
  • Plastic tubing PUN-H-10X1,5-GE (558302)
  • Plastic tubing PUN-H-10X1,5-GN (558295)
  • Plastic tubing PUN-H-10X1,5-NT (197379)
  • Plastic tubing PUN-H-10X1,5-NT-100-CS (8226423)
  • Plastic tubing PUN-H-10X1,5-NT-300 (558267)
  • Plastic tubing PUN-H-10X1,5-RT (558288)
  • Plastic tubing PUN-H-10X1,5-RT-25 (8204448)
  • Plastic tubing PUN-H-10X1,5-SI (558281)
  • Plastic tubing PUN-H-10X1,5-SI-100-CS (8226424)
  • Plastic tubing PUN-H-10X1,5-SI-300 (558274)
  • Plastic tubing PUN-H-10X1,5-SW (197393)
  • Plastic tubing PUN-H-10X1,5-SW-100-CS (8226425)
  • Plastic tubing PUN-H-10X1,5-SW-25 (8204443)
  • Plastic tubing PUN-H-10X1,5-SW-300 (558253)
  • Plastic tubing PUN-H-10X1,5-TBL (8048701)
  • Plastic tubing PUN-H-10X1,5-TBL-100-CS (8226426)
  • Plastic tubing PUN-H-10X1,5-TBL-25 (8205521)
  • Plastic tubing PUN-H-10X1,5-TBL-300 (8048702)
  • Plastic tubing PUN-H-10X1,5-TGE (8048709)
  • Plastic tubing PUN-H-10X1,5-TGE-100-CS (8226427)
  • Plastic tubing PUN-H-10X1,5-TGE-300 (8048710)
  • Plastic tubing PUN-H-10X1,5-TGN (8048707)
  • Plastic tubing PUN-H-10X1,5-TGN-100-CS (8226428)
  • Plastic tubing PUN-H-10X1,5-TGN-300 (8048708)
  • Plastic tubing PUN-H-10X1,5-TRT (8048705)
  • Plastic tubing PUN-H-10X1,5-TRT-100-CS (8226429)
  • Plastic tubing PUN-H-10X1,5-TRT-300 (8048706)
  • Plastic tubing PUN-H-10X1,5-TSW (8048703)
  • Plastic tubing PUN-H-10X1,5-TSW-100-CS (8226430)
  • Plastic tubing PUN-H-10X1,5-TSW-300 (8048704)
  • Plastic tubing PUN-H-12-GN-200-HA (8200018)
  • Plastic tubing PUN-H-12-NT-100-HA (8150422)
  • Plastic tubing PUN-H-12X2-BL (197387)
  • Plastic tubing PUN-H-12X2-BL-100-CS (8227654)
  • Plastic tubing PUN-H-12X2-BL-200 (558261)
  • Plastic tubing PUN-H-12X2-BL-25 (8204442)
  • Plastic tubing PUN-H-12X2-GE (558303)
  • Plastic tubing PUN-H-12X2-GN (558296)
  • Plastic tubing PUN-H-12X2-NT (197380)
  • Plastic tubing PUN-H-12X2-NT-100-CS (8226414)
  • Plastic tubing PUN-H-12X2-NT-200 (558268)
  • Plastic tubing PUN-H-12X2-RT (558289)
  • Plastic tubing PUN-H-12X2-RT-25 (8204449)
  • Plastic tubing PUN-H-12X2-SI (558282)
  • Plastic tubing PUN-H-12X2-SI-100-CS (8226415)
  • Plastic tubing PUN-H-12X2-SI-200 (558275)
  • Plastic tubing PUN-H-12X2-SW (197394)
  • Plastic tubing PUN-H-12X2-SW-100-CS (8226416)
  • Plastic tubing PUN-H-12X2-SW-200 (558254)
  • Plastic tubing PUN-H-12X2-SW-25 (8204444)
  • Plastic tubing PUN-H-12X2-TBL (8048711)
  • Plastic tubing PUN-H-12X2-TBL-100-CS (8226417)
  • Plastic tubing PUN-H-12X2-TBL-200 (8048712)
  • Plastic tubing PUN-H-12X2-TBL-25 (8205522)
  • Plastic tubing PUN-H-12X2-TGE (8048719)
  • Plastic tubing PUN-H-12X2-TGE-100-CS (8226418)
  • Plastic tubing PUN-H-12X2-TGE-200 (8048720)
  • Plastic tubing PUN-H-12X2-TGN (8048717)
  • Plastic tubing PUN-H-12X2-TGN-100-CS (8226419)
  • Plastic tubing PUN-H-12X2-TGN-200 (8048718)
  • Plastic tubing PUN-H-12X2-TRT (8048715)
  • Plastic tubing PUN-H-12X2-TRT-100-CS (8226420)
  • Plastic tubing PUN-H-12X2-TRT-200 (8048716)
  • Plastic tubing PUN-H-12X2-TSW (8048713)
  • Plastic tubing PUN-H-12X2-TSW-100-CS (8226421)
  • Plastic tubing PUN-H-12X2-TSW-200 (8048714)
  • Plastic tubing PUN-H-14X2-BL (570386)
  • Plastic tubing PUN-H-14X2-NT (570388)
  • Plastic tubing PUN-H-14X2-SW (570387)
  • Plastic tubing PUN-H-16-GN-100-HA (8200019)
  • Plastic tubing PUN-H-16X2,5-BL (197388)
  • Plastic tubing PUN-H-16X2,5-BL-100 (558262)
  • Plastic tubing PUN-H-16X2,5-GE (558304)
  • Plastic tubing PUN-H-16X2,5-GN (558297)
  • Plastic tubing PUN-H-16X2,5-NT (197381)
  • Plastic tubing PUN-H-16X2,5-NT-100 (558269)
  • Plastic tubing PUN-H-16X2,5-RT (558290)
  • Plastic tubing PUN-H-16X2,5-SI (558283)
  • Plastic tubing PUN-H-16X2,5-SI-100 (558276)
  • Plastic tubing PUN-H-16X2,5-SW (197395)
  • Plastic tubing PUN-H-16X2,5-SW-100 (558255)
  • Plastic tubing PUN-H-3X0,5-BL (197382)
  • Plastic tubing PUN-H-3X0,5-BL-500 (558256)
  • Plastic tubing PUN-H-3X0,5-GE (558298)
  • Plastic tubing PUN-H-3X0,5-GN (558291)
  • Plastic tubing PUN-H-3X0,5-NT (197375)
  • Plastic tubing PUN-H-3X0,5-NT-500 (558263)
  • Plastic tubing PUN-H-3X0,5-RT (558284)
  • Plastic tubing PUN-H-3X0,5-SI (558277)
  • Plastic tubing PUN-H-3X0,5-SI-500 (558270)
  • Plastic tubing PUN-H-3X0,5-SW (197389)
  • Plastic tubing PUN-H-3X0,5-SW-500 (558249)
  • Plastic tubing PUN-H-4X0,75-BL (197383)
  • Plastic tubing PUN-H-4X0,75-BL-200-CS (8226449)
  • Plastic tubing PUN-H-4X0,75-BL-25 (8205512)
  • Plastic tubing PUN-H-4X0,75-BL-500 (558257)
  • Plastic tubing PUN-H-4X0,75-GE (558299)
  • Plastic tubing PUN-H-4X0,75-GN (558292)
  • Plastic tubing PUN-H-4X0,75-NT (197376)
  • Plastic tubing PUN-H-4X0,75-NT-200-CS (8226450)
  • Plastic tubing PUN-H-4X0,75-NT-500 (558264)
  • Plastic tubing PUN-H-4X0,75-RT (558285)
  • Plastic tubing PUN-H-4X0,75-RT-25 (8204445)
  • Plastic tubing PUN-H-4X0,75-SI (558278)
  • Plastic tubing PUN-H-4X0,75-SI-200-CS (8226451)
  • Plastic tubing PUN-H-4X0,75-SI-500 (558271)
  • Plastic tubing PUN-H-4X0,75-SW (197390)
  • Plastic tubing PUN-H-4X0,75-SW-200-CS (8226452)
  • Plastic tubing PUN-H-4X0,75-SW-25 (8205515)
  • Plastic tubing PUN-H-4X0,75-SW-500 (558250)
  • Plastic tubing PUN-H-4X0,75-TBL (8048671)
  • Plastic tubing PUN-H-4X0,75-TBL-200-CS (8226453)
  • Plastic tubing PUN-H-4X0,75-TBL-25 (8205518)
  • Plastic tubing PUN-H-4X0,75-TBL-500 (8048672)
  • Plastic tubing PUN-H-4X0,75-TGE (8048679)
  • Plastic tubing PUN-H-4X0,75-TGE-200-CS (8226454)
  • Plastic tubing PUN-H-4X0,75-TGE-500 (8048680)
  • Plastic tubing PUN-H-4X0,75-TGN (8048677)
  • Plastic tubing PUN-H-4X0,75-TGN-200-CS (8226455)
  • Plastic tubing PUN-H-4X0,75-TGN-500 (8048678)
  • Plastic tubing PUN-H-4X0,75-TRT (8048675)
  • Plastic tubing PUN-H-4X0,75-TRT-200-CS (8226456)
  • Plastic tubing PUN-H-4X0,75-TRT-500 (8048676)
  • Plastic tubing PUN-H-4X0,75-TSW (8048673)
  • Plastic tubing PUN-H-4X0,75-TSW-200-CS (8226457)
  • Plastic tubing PUN-H-4X0,75-TSW-500 (8048674)
  • Plastic tubing PUN-H-6X1-BL (197384)
  • Plastic tubing PUN-H-6X1-BL-200-CS (8226440)
  • Plastic tubing PUN-H-6X1-BL-25 (8205513)
  • Plastic tubing PUN-H-6X1-BL-500 (558258)
  • Plastic tubing PUN-H-6X1-GE (558300)
  • Plastic tubing PUN-H-6X1-GN (558293)
  • Plastic tubing PUN-H-6X1-NT (197377)
  • Plastic tubing PUN-H-6X1-NT-200-CS (8226441)
  • Plastic tubing PUN-H-6X1-NT-500 (558265)
  • Plastic tubing PUN-H-6X1-RT (558286)
  • Plastic tubing PUN-H-6X1-RT-25 (8204446)
  • Plastic tubing PUN-H-6X1-SI (558279)
  • Plastic tubing PUN-H-6X1-SI-200-CS (8226442)
  • Plastic tubing PUN-H-6X1-SI-500 (558272)
  • Plastic tubing PUN-H-6X1-SW (197391)
  • Plastic tubing PUN-H-6X1-SW-200-CS (8226443)
  • Plastic tubing PUN-H-6X1-SW-25 (8205516)
  • Plastic tubing PUN-H-6X1-SW-500 (558251)
  • Plastic tubing PUN-H-6X1-TBL (8048681)
  • Plastic tubing PUN-H-6X1-TBL-200-CS (8226444)
  • Plastic tubing PUN-H-6X1-TBL-25 (8205519)
  • Plastic tubing PUN-H-6X1-TBL-500 (8048682)
  • Plastic tubing PUN-H-6X1-TGE (8048689)
  • Plastic tubing PUN-H-6X1-TGE-200-CS (8226445)
  • Plastic tubing PUN-H-6X1-TGE-500 (8048690)
  • Plastic tubing PUN-H-6X1-TGN (8048687)
  • Plastic tubing PUN-H-6X1-TGN-200-CS (8226446)
  • Plastic tubing PUN-H-6X1-TGN-500 (8048688)
  • Plastic tubing PUN-H-6X1-TRT (8048685)
  • Plastic tubing PUN-H-6X1-TRT-200-CS (8226447)
  • Plastic tubing PUN-H-6X1-TRT-500 (8048686)
  • Plastic tubing PUN-H-6X1-TSW (8048683)
  • Plastic tubing PUN-H-6X1-TSW-200-CS (8226448)
  • Plastic tubing PUN-H-6X1-TSW-500 (8048684)
  • Plastic tubing PUN-H-8X1,25-BL (197385)
  • Plastic tubing PUN-H-8X1,25-BL-100-CS (8226431)
  • Plastic tubing PUN-H-8X1,25-BL-25 (8205514)
  • Plastic tubing PUN-H-8X1,25-BL-400 (558259)
  • Plastic tubing PUN-H-8X1,25-GE (558301)
  • Plastic tubing PUN-H-8X1,25-GN (558294)
  • Plastic tubing PUN-H-8X1,25-NT (197378)
  • Plastic tubing PUN-H-8X1,25-NT-100-CS (8226432)
  • Plastic tubing PUN-H-8X1,25-NT-400 (558266)
  • Plastic tubing PUN-H-8X1,25-RT (558287)
  • Plastic tubing PUN-H-8X1,25-RT-25 (8204447)
  • Plastic tubing PUN-H-8X1,25-SI (558280)
  • Plastic tubing PUN-H-8X1,25-SI-100-CS (8226433)
  • Plastic tubing PUN-H-8X1,25-SI-400 (558273)
  • Plastic tubing PUN-H-8X1,25-SW (197392)
  • Plastic tubing PUN-H-8X1,25-SW-100-CS (8226434)
  • Plastic tubing PUN-H-8X1,25-SW-25 (8205517)
  • Plastic tubing PUN-H-8X1,25-SW-400 (558252)
  • Plastic tubing PUN-H-8X1,25-TBL (8048691)
  • Plastic tubing PUN-H-8X1,25-TBL-100-CS (8226435)
  • Plastic tubing PUN-H-8X1,25-TBL-25 (8205520)
  • Plastic tubing PUN-H-8X1,25-TBL-400 (8048692)
  • Plastic tubing PUN-H-8X1,25-TGE (8048699)
  • Plastic tubing PUN-H-8X1,25-TGE-100-CS (8226436)
  • Plastic tubing PUN-H-8X1,25-TGE-400 (8048700)
  • Plastic tubing PUN-H-8X1,25-TGN (8048697)
  • Plastic tubing PUN-H-8X1,25-TGN-100-CS (8226437)
  • Plastic tubing PUN-H-8X1,25-TGN-400 (8048698)
  • Plastic tubing PUN-H-8X1,25-TRT (8048695)
  • Plastic tubing PUN-H-8X1,25-TRT-100-CS (8226438)
  • Plastic tubing PUN-H-8X1,25-TRT-400 (8048696)
  • Plastic tubing PUN-H-8X1,25-TSW (8048693)
  • Plastic tubing PUN-H-8X1,25-TSW-100-CS (8226439)
  • Plastic tubing PUN-H-8X1,25-TSW-400 (8048694)
  • Plastic tubing PUN-H-SF-10X2-BL (8167904)
  • Plastic tubing PUN-H-SF-10X2-SW (8167905)
  • Plastic tubing PUN-H-SF-12X2,3-BL (8167907)
  • Plastic tubing PUN-H-SF-12X2,3-SW (8167906)
  • Plastic tubing PUN-H-SF-14X2,7-BL (8167909)
  • Plastic tubing PUN-H-SF-14X2,7-SW (8167908)
  • Plastic tubing PUN-H-SF-16X3,1-BL (8167911)
  • Plastic tubing PUN-H-SF-16X3,1-SW (8167910)
  • Plastic tubing PUN-H-SF-18X3,4-BL-25 (8167912)
  • Plastic tubing PUN-H-SF-18X3,4-SW-25 (8167913)
  • Plastic tubing PUN-H-SF-22X4,3-BL-25 (8167915)
  • Plastic tubing PUN-H-SF-22X4,3-SW-25 (8167914)
  • Plastic tubing PUN-H-SF-25X4,85-BL-25 (8167916)
  • Plastic tubing PUN-H-SF-25X4,85-SW-25 (8167917)
  • Plastic tubing PUN-H-SF-4X0,85-BL (8174912)
  • Plastic tubing PUN-H-SF-4X0,85-SW (8174911)
  • Plastic tubing PUN-H-SF-6X1,25-BL (8167900)
  • Plastic tubing PUN-H-SF-6X1,25-SW (8167899)
  • Plastic tubing PUN-H-SF-8X1,55-BL (8167902)
  • Plastic tubing PUN-H-SF-8X1,55-SW (8167901)
  • Plastic tubing PUN-V0-10X1,5-BL (525444)
  • Plastic tubing PUN-V0-10X1,5-BR (525464)
  • Plastic tubing PUN-V0-10X1,5-GE (525460)
  • Plastic tubing PUN-V0-10X1,5-GN (525448)
  • Plastic tubing PUN-V0-10X1,5-RT (525452)
  • Plastic tubing PUN-V0-10X1,5-SW (525440)
  • Plastic tubing PUN-V0-10X1,5-WS (525456)
  • Plastic tubing PUN-V0-10X2-BL-C (561704)
  • Plastic tubing PUN-V0-10X2-BR-C (561724)
  • Plastic tubing PUN-V0-10X2-GE-C (561720)
  • Plastic tubing PUN-V0-10X2-GN-C (561708)
  • Plastic tubing PUN-V0-10X2-RT-C (561712)
  • Plastic tubing PUN-V0-10X2-SW-C (561700)
  • Plastic tubing PUN-V0-10X2-WS-C (561716)
  • Plastic tubing PUN-V0-12X2-BL-C (561705)
  • Plastic tubing PUN-V0-12X2-BR-C (561725)
  • Plastic tubing PUN-V0-12X2-GE-C (561721)
  • Plastic tubing PUN-V0-12X2-GN-C (561709)
  • Plastic tubing PUN-V0-12X2-RT-C (561713)
  • Plastic tubing PUN-V0-12X2-SW-C (561701)
  • Plastic tubing PUN-V0-12X2-WS-C (561717)
  • Plastic tubing PUN-V0-14X2-BL-C (570352)
  • Plastic tubing PUN-V0-14X2-SW-C (570351)
  • Plastic tubing PUN-V0-16X2,5-BL-C (570354)
  • Plastic tubing PUN-V0-16X2,5-SW-C (570353)
  • Plastic tubing PUN-V0-16X2-BL (570768)
  • Plastic tubing PUN-V0-16X2-SW (570767)
  • Plastic tubing PUN-V0-4X1-BL-C (570350)
  • Plastic tubing PUN-V0-4X1-SW-C (570349)
  • Plastic tubing PUN-V0-6X1-BL (525442)
  • Plastic tubing PUN-V0-6X1-BR (525462)
  • Plastic tubing PUN-V0-6X1-GE (525458)
  • Plastic tubing PUN-V0-6X1-GN (525446)
  • Plastic tubing PUN-V0-6X1-RT (525450)
  • Plastic tubing PUN-V0-6X1-SW (525438)
  • Plastic tubing PUN-V0-6X1-WS (525454)
  • Plastic tubing PUN-V0-6X2-BL-C (561702)
  • Plastic tubing PUN-V0-6X2-BR-C (561722)
  • Plastic tubing PUN-V0-6X2-GE-C (561718)
  • Plastic tubing PUN-V0-6X2-GN-C (561706)
  • Plastic tubing PUN-V0-6X2-RT-C (561710)
  • Plastic tubing PUN-V0-6X2-SW-C (561698)
  • Plastic tubing PUN-V0-6X2-WS-C (561714)
  • Plastic tubing PUN-V0-8X1,25-BL (525443)
  • Plastic tubing PUN-V0-8X1,25-BR (525463)
  • Plastic tubing PUN-V0-8X1,25-GE (525459)
  • Plastic tubing PUN-V0-8X1,25-GN (525447)
  • Plastic tubing PUN-V0-8X1,25-RT (525451)
  • Plastic tubing PUN-V0-8X1,25-SW (525439)
  • Plastic tubing PUN-V0-8X1,25-WS (525455)
  • Plastic tubing PUN-V0-8X2-BL-C (561703)
  • Plastic tubing PUN-V0-8X2-BR-C (561723)
  • Plastic tubing PUN-V0-8X2-GE-C (561719)
  • Plastic tubing PUN-V0-8X2-GN-C (561707)
  • Plastic tubing PUN-V0-8X2-RT-C (561711)
  • Plastic tubing PUN-V0-8X2-SW-C (561699)
  • Plastic tubing PUN-V0-8X2-WS-C (561715)
  • Plastic tubing PUN-V0C-10-BL-50-CB (8226718)
  • Plastic tubing PUN-V0C-10-GN-50-CB (8226719)
  • Plastic tubing PUN-V0C-10-RT-50-CB (8226720)
  • Plastic tubing PUN-V0C-10-SW-50-CB (8226721)
  • Plastic tubing PUN-V0C-10-WS-50-CB (8226722)
  • Plastic tubing PUN-V0C-12-BL-50-CB (8226723)
  • Plastic tubing PUN-V0C-12-GN-50-CB (8226724)
  • Plastic tubing PUN-V0C-12-RT-50-CB (8226725)
  • Plastic tubing PUN-V0C-12-SW-50-CB (8226726)
  • Plastic tubing PUN-V0C-12-WS-50-CB (8226727)
  • Plastic tubing PUN-V0C-14-BL-50-CB (8226728)
  • Plastic tubing PUN-V0C-14-GN-50-CB (8210242)
  • Plastic tubing PUN-V0C-14-SW-50-CB (8226729)
  • Plastic tubing PUN-V0C-14-WS-50-CB (8210241)
  • Plastic tubing PUN-V0C-16-BL-50-CB (8226730)
  • Plastic tubing PUN-V0C-16-GN-50-CB (8210245)
  • Plastic tubing PUN-V0C-16-RT-50-CB (8210244)
  • Plastic tubing PUN-V0C-16-SW-50-CB (8226731)
  • Plastic tubing PUN-V0C-16-WS-50-CB (8210243)
  • Plastic tubing PUN-V0C-4-GN-50-CB (8210240)
  • Plastic tubing PUN-V0C-4-RT-50-CB (8210239)
  • Plastic tubing PUN-V0C-4-WS-50-CB (8210238)
  • Plastic tubing PUN-V0C-8-BL-50-CB (8226713)
  • Plastic tubing PUN-V0C-8-GN-50-CB (8226714)
  • Plastic tubing PUN-V0C-8-RT-50-CB (8226715)
  • Plastic tubing PUN-V0C-8-SW-50-CB (8226716)
  • Plastic tubing PUN-V0C-8-WS-50-CB (8226717)
  • Plate AIR PREPARATION PLATE (573990)
  • Plate CMCZ-M-2-007-31-0770-CS (8048253)
  • Plate CMCZ-M-2-007-31-1100-CS (8058531)
  • Pneumatic Drive Assembly ADNH-80-CS (8188637)
  • Pneumatic module VTUG+VUVG-CS (8153661)
  • PRE-assembly RUECKSCHLAGVENTIL-BG (1750195)
  • Preset counter D:TP-BG-PZV-Q4 (152877)
  • Pressure booster DPA-100-10-CRVZS20 (552936)
  • Pressure booster DPA-100-16-CRVZS20 (552937)
  • Pressure booster DPA-40-10-CRVZS2 (552928)
  • Pressure booster DPA-40-10-CRVZS5 (552930)
  • Pressure booster DPA-40-16-CRVZS2 (552929)
  • Pressure booster DPA-40-16-CRVZS5 (552931)
  • Pressure booster DPA-63-10-CRVZS10 (552932)
  • Pressure booster DPA-63-10-CRVZS20 (552934)
  • Pressure booster DPA-63-16-CRVZS10 (552933)
  • Pressure booster DPA-63-16-CRVZS20 (552935)
  • Pressure regulator BAUGRUPPE MS6-LRB-VUVG (8044605)
  • Pressure regulator MS12-LR-G-PE6-Z-CS (8118102)
  • Pressure regulator MS4-LR-CS (8153649)
  • Pressure sequence valve D:PPV-VD-GESCHR. (548667)
  • pressure vacuum generator PGVA-1-P-D30-Q4-A (8165129)
  • pressure vacuum generator PGVA-2-P1V1-Q4-A (8163214)
  • pressure vacuum generator PGVA-CS (8146318)
  • proximity switch D:ER-SMPO-1-H B (34002)
  • proximity switch D:S-PSS-SMPO (152870)
  • proximity switch SME-10M-DS-24V-E-0,3-L-M8D (551367)
  • Round cylinder KDPR-DSNU (2915960)
  • Round cylinder KDPR-DSNU-S (8155045)
  • RUNDSCHALTT. P D:MP-M-RP-260 (35666)
  • Semi-rotary drive DRRD-50-180-P2-P-CS (5397016)
  • Semi-rotary drive KDRD-DRRD (8046539)
  • Service unit 3492350-0001 (8109104)
  • Service unit BCP7-CS (8140994)
  • Service unit HE-LF-1/4-DB-MINI-H-S-CS (4136082)
  • Service unit HE-LFR-1/4-DB-6-MINI-H-S-CS (4240556)
  • Service unit MS4+VOFA-CS (8195642)
  • Set of components D:WSI-INDMECH-P-SET (8169913)
  • Set of components D:WS-MPS-SPAREPART-SET (8170329)
  • Set of small components D:MP3-KT-STANZEN (526894)
  • Set of small components D:MP3-M:PUFFERN (526208)
  • Set of small components D:MP3-M:VERTEILEN (526209)
  • Set of small components D:MP3-M-KTPA:PICKEN (526866)
  • Set of small components D:MP3-M-KTPR:PRUEFEN (526865)
  • Set of small components D:MP3-M-KTS:SORTIEREN (526207)
  • Set of small components D:MP4-AS-P (8041776)
  • Short-stroke cylinder KDPS-AEVC (8046536)
  • Small parts D:MP3-M-KT-VE-ASI-BS (535240)
  • Solenoid valve 2-041-01-4590 TRENNMITTEL 2 (8059184)
  • Solenoid valve MHP3-M1H-3/2G-QS-6-CS (3297955)
  • Solenoid valve TRENNMITTEL 2 VUVG-L14-T32C-MZT-G18-1R8L-CS (8044548)
  • Solenoid valve VUVG-L10-M32C-ATM5-1S2RL-CS (8059507)
  • Spiral plastic tubing PUN-10X1,5-S-1-BL (197596)
  • Spiral plastic tubing PUN-10X1,5-S-1-SW (197611)
  • Spiral plastic tubing PUN-10X1,5-S-2-BL (197597)
  • Spiral plastic tubing PUN-10X1,5-S-2-SW (197612)
  • Spiral plastic tubing PUN-10X1,5-S-6-BL (197598)
  • Spiral plastic tubing PUN-10X1,5-S-6-SW (197613)
  • Spiral plastic tubing PUN-12X2-S-1-BL (197599)
  • Spiral plastic tubing PUN-12X2-S-1-SW (197614)
  • Spiral plastic tubing PUN-12X2-S-2-BL (197600)
  • Spiral plastic tubing PUN-12X2-S-2-SW (197615)
  • Spiral plastic tubing PUN-12X2-S-6-BL (197601)
  • Spiral plastic tubing PUN-12X2-S-6-SW (197616)
  • Spiral plastic tubing PUN-4X0,75-S-0,5-BL (197587)
  • Spiral plastic tubing PUN-4X0,75-S-0,5-SW (197602)
  • Spiral plastic tubing PUN-4X0,75-S-1,5-BL (197589)
  • Spiral plastic tubing PUN-4X0,75-S-1,5-SW (197604)
  • Spiral plastic tubing PUN-4X0,75-S-1-BL (197588)
  • Spiral plastic tubing PUN-4X0,75-S-1-SW (197603)
  • Spiral plastic tubing PUN-6X1-S-1-BL (197590)
  • Spiral plastic tubing PUN-6X1-S-1-SW (197605)
  • Spiral plastic tubing PUN-6X1-S-2-BL (197591)
  • Spiral plastic tubing PUN-6X1-S-2-SW (197606)
  • Spiral plastic tubing PUN-6X1-S-6-BL (197592)
  • Spiral plastic tubing PUN-6X1-S-6-SW (197607)
  • Spiral plastic tubing PUN-8X1,25-S-1-BL (197593)
  • Spiral plastic tubing PUN-8X1,25-S-1-SW (197608)
  • Spiral plastic tubing PUN-8X1,25-S-2-BL (197594)
  • Spiral plastic tubing PUN-8X1,25-S-2-SW (197609)
  • Spiral plastic tubing PUN-8X1,25-S-6-BL (197595)
  • Spiral plastic tubing PUN-8X1,25-S-6-SW (197610)
  • standards-based cylinder KDPR-DSN (8046540)
  • standards-based cylinder KDSB-DSBC (2926683)
  • Station D:MP2-S1/2-MAG. (120892)
  • Station D:MP2-S-BA (120882)
  • Station D:MP2-S-FT (120886)
  • Station D:MP2-S-HH (120883)
  • Station D:MP2-S-HHG (167036)
  • Station D:MP2-S-HS (120888)
  • Station D:MP2-S-PB (120884)
  • Station D:MP2-S-PR (120881)
  • Station D:MP2-S-S (120887)
  • Station D:MP2-S-V (120880)
  • Stepper module D:ER-TAA-PK-4 B (9762)
  • Suction cup with connector D:MP-B-ME-SF-10MM (111883)
  • Suction gripper D:MP4-ACC-VSG-CS/SNA-KPL (8065380)
  • Supplementary set H6_805_018_00_04 (538517)
  • Swivel module D:IK-BG-DSR-16-180-KPL (527435)
  • System D:MP4-A-405-R-230V-S1512 (8206627)
  • Three-dimensional gantry YXMR-1 (8082255)
  • Training system D:BIO-KIT-M-KPL (8088920)
  • Vacuum block FA. BOBST (569770)
  • Vacuum generator D:S-PAV-VAD (152891)
  • Valve block BASIC MODULE (2065455)
  • Valve block BCPE-4X2/2-22-SA (3165267)
  • Valve block BCPE-4X2/2-22-SA (8069874)
  • Valve block VHB-2/2-HD-SA (2757831)
  • Valve manifold MHA1-8-CS (8126088)
  • Valve module MAGAZINKLAPPE RECHTS (575468)
  • Valve terminal SET 3394173-0100_AC (8073652)
  • Valve terminal SET 3394173-1_AC (8121388)
  • Valve terminal SET CARBONSTAR II (8110284)
  • Valve terminal SET CARBONSTAR II (8173215)
  • Valve terminal SET TWINSTAR I (8126198)
  • Valve terminal SET TWINSTAR II 4WV (8110282)
  • Valve terminal SET TWINSTAR II 5WV (8110283)
  • Valve terminal SET TWINSTAR II4WV (8173216)
  • Valve terminal SET TWO60BIG (8110996)
  • Valve terminal SET VTUG-10 CON ACCESSORI (8081824)
  • Valve terminal CADC-VTP-.. (8077435)
  • Valve terminal CPV14-2-FACH (541314)
  • Valve terminal VTUG-14 "MP...MTRGMTPL" (8058557)
  • valve unit VUVG-CS (8153657)
  • valve unit VUVG-LK-CS (8153651)
  • Valve D:S-PSV-SDV-3 (152868)
  • WINKELBLECH-BG . (1706641)

Top downloads

Information on substances in our products Substances in our products; Compliance

Festo SE & Co KG complies with national and international laws, guidelines, standards and regulations which are applicable to our products. We constantly monitor the dynamics of legislation. This Application Note give an overview.

2.90
02/07/2025
Terms of use for electronic documentation
Catalogue for Process Automation
When searching, you can get detailed product information (e.g. CAD support and technical data) with part no. or order code.
If they are not available, use the Product selection in the catalogue.